• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens acetyl-CoA acetyltransferase 1 (ACAT1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu45759 Homo sapiens acetyl-CoA acetyltransferase 1 (ACAT1), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu45759C Homo sapiens acetyl-CoA acetyltransferase 1 (ACAT1), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000019.3, 223890189
Length 1284 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens acetyl-CoA acetyltransferase 1 (ACAT1), mRNA.
Product acetyl-CoA acetyltransferase, mitochondrial precursor
Comment

Summary: This gene encodes a mitochondrially localized enzyme that catalyzes the reversible formation of acetoacetyl-CoA from two molecules of acetyl-CoA. Defects in this gene are associated with 3-ketothiolase deficiency, an inborn error of isoleucine catabolism characterized by urinary excretion of 2-methyl-3-hydroxybutyric acid, 2-methylacetoacetic acid, tiglylglycine, and butanone. [provided by RefSeq, Feb 2009].

RefSeq NP_000010.1
CDS 77..1360
Misc Feature(1)194..1357
Misc Feature(2)203..1354
Misc Feature(3)order(257..259,338..340,380..382,389..391,401..403,
Misc Feature(4)order(452..454,1229..1231,1313..1315)
Misc Feature(5)596..598
Misc Feature(6)617..619
Misc Feature(7)827..829
Misc Feature(8)848..856
Misc Feature(9)863..865
Exon (1)1..148
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (2)149..196
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (3)197..314
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (4)315..410
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (5)411..511
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (6)512..655
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (7)656..806
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (8)807..902
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (9)903..1016
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (10)1017..1081
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (11)1082..1239
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Exon (12)1240..2138
Gene:ACAT1
Gene Synonym:ACAT; MAT; T2; THIL
Translation MAVLAALLRSGARSRSPLLRRLVQEIRYVERSYVSKPTLKEVVIVSATRTPIGSFLGSLS LLPATKLGSIAIQGAIEKAGIPKEEVKEAYMGNVLQGGEGQAPTRQAVLGAGLPISTPCT TINKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIV KDGLTDVYNKIHMGSCAENTAKKLNIARNEQDAYAINSYTRSKAAWEAGKFGNEVIPVTV TVKGQPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTVTAANASTLNDGAAALVLMTADA AKRLNVTPLARIVAFADAAVEPIDFPIAPVYAASMVLKDVGLKKEDIAMWEVNEAFSLVV LANIKMLEIDPQKVNINGGAVSLGHPIGMSGARIVGHLTHALKQGEYGLASICNGGGGAS AMLIQKL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
49+a, tdbSNP:36216231
55+c, gdbSNP:3741054
62+c, gdbSNP:113348145
65+a, c, tdbSNP:112219560
67+c, tdbSNP:373627341
68..69+, cdbSNP:34512802
68+a, tdbSNP:3741055
78+a, tdbSNP:120074142
89..90+c, gdbSNP:11540420
89+c, gdbSNP:3741056
136+c, gdbSNP:77311724
143+c, gdbSNP:375362239
167+dbSNP:
167+c, tdbSNP:199952982
189+c, tdbSNP:142869776
215+dbSNP:
215+a, gdbSNP:115763401
231+c, tdbSNP:151080188
250+c, gdbSNP:147018814
322+dbSNP:
322+, adbSNP:34607623
354+a, gdbSNP:120074145
359+c, tdbSNP:56061117
419+dbSNP:
419+a, gdbSNP:138104334
424+c, tdbSNP:372836412
460+a, gdbSNP:374439037
509+c, gdbSNP:120074148
525+dbSNP:
525+a, cdbSNP:149522535
547+a, c, gdbSNP:35188041
548+a, gdbSNP:148639841
549+a, gdbSNP:199524907
556+a, gdbSNP:141131039
583+a, tdbSNP:201456540
598+c, gdbSNP:146188525
608+c, tdbSNP:370063325
622+c, tdbSNP:373393997
623+a, gdbSNP:120074141
683+a, cdbSNP:200498630
699+a, gdbSNP:370720208
734+a, gdbSNP:199573646
846+dbSNP:
846+a, cdbSNP:370652435
890+c, tdbSNP:120074144
892+g, tdbSNP:139120939
917+dbSNP:
917+a, gdbSNP:200640435
928+c, tdbSNP:200210306
934+a, gdbSNP:143892373
943+a, cdbSNP:201725995
962+a, gdbSNP:368802454
967+a, gdbSNP:372169445
979+a, gdbSNP:75811190
981+, adbSNP:398123097
983+a, tdbSNP:201180840
994+a, tdbSNP:200318899
1011+c, tdbSNP:120074146
1023+dbSNP:
1023+c, tdbSNP:371656619
1054+a, cdbSNP:73559264
1055+a, gdbSNP:150038447
1061+a, cdbSNP:375119115
1073+c, gdbSNP:120074147
1079+a, gdbSNP:369440498
1098+dbSNP:
1098+a, gdbSNP:80154645
1104+a, gdbSNP:149171104
1109..1111+, gaadbSNP:387906282
1144+c, tdbSNP:139657823
1159..1160+, adbSNP:387906283
1200+a, gdbSNP:373771053
1212+g, tdbSNP:120074143
1214+a, gdbSNP:120074140
1243+dbSNP:
1243+a, gdbSNP:377295639
1248+c, gdbSNP:371070695
1274+c, tdbSNP:201183545
1285+a, gdbSNP:200729208
1293+a, gdbSNP:147872303
1297+c, tdbSNP:367713788
1306+c, tdbSNP:189339614
1355+a, cdbSNP:201500937
1364..1365+, cdbSNP:111390656
1388+c, tdbSNP:370288623
1474+g, tdbSNP:373499678
1497+a, tdbSNP:192326657
1528..1533+, taaaaadbSNP:201268334
1539..1541+, ttcdbSNP:372218361
1539+g, tdbSNP:114728153
complement(1574)-g, cdbSNP:145690535
1603+c, tdbSNP:148934438
1610+c, tdbSNP:79179095
1618+a, gdbSNP:79764488
1653+a, tdbSNP:73559273
1715+c, gdbSNP:114039574
1717+a, cdbSNP:373983292
1725+c, tdbSNP:145398051
1867+a, gdbSNP:12271846
1867+a, gdbSNP:386433238
1913+a, tdbSNP:183999318
1915+a, gdbSNP:111376037
1959+a, cdbSNP:2280332
1997+a, gdbSNP:116471564
2063+a, tdbSNP:188826374
2067+c, tdbSNP:181581446
2104..2105+, gadbSNP:373601338
2113+c, tdbSNP:186239800
2114+a, gdbSNP:147695530
Gene SymbolACAT1
Gene SynonymACAT; MAT; T2; THIL
Chromosome11
Locus Map11q22.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000019 Homo sapiens acetyl-CoA acetyltransferase 1 (ACAT1), mRNA. On-demand $219.00 7-9
XM_006718834 PREDICTED: Homo sapiens acetyl-CoA acetyltransferase 1 (ACAT1), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_006718835 PREDICTED: Homo sapiens acetyl-CoA acetyltransferase 1 (ACAT1), transcript variant X2, mRNA. On-demand $219.00 7-9
Title Evaluation and prognostic significance of ACAT1 as a marker of prostate cancer progression .
Author Saraon P, Trudel D, Kron K, Dmitromanolakis A, Trachtenberg J, Bapat B, van der Kwast T, Jarvi KA and Diamandis EP.
Journal Prostate 74 (4), 372-380 (2014)
Title Tyr phosphorylation of PDP1 toggles recruitment between ACAT1 and SIRT3 to regulate the pyruvate dehydrogenase complex .
Author Fan J, Shan C, Kang HB, Elf S, Xie J, Tucker M, Gu TL, Aguiar M, Lonning S, Chen H, Mohammadi M, Britton LM, Garcia BA, Aleckovic M, Kang Y, Kaluz S, Devi N, Van Meir EG, Hitosugi T, Seo JH, Lonial S, Gaddh M, Arellano M, Khoury HJ, Khuri FR, Boggon TJ, Kang S and Chen J.
Journal Mol. Cell 53 (4), 534-548 (2014)
Title Insulin induces human acyl-coenzyme A: cholesterol acyltransferase1 gene expression via MAP kinases and CCAAT/enhancer-binding protein alpha .
Author Ge J, Zhai W, Cheng B, He P, Qi B, Lu H, Zeng Y and Chen X.
Journal J. Cell. Biochem. 114 (9), 2188-2198 (2013)
Title Production of ACAT1 56-kDa isoform in human cells via trans-splicing involving the ampicillin resistance gene .
Author Hu GJ, Chen J, Zhao XN, Xu JJ, Guo DQ, Lu M, Zhu M, Xiong Y, Li Q, Chang CC, Song BL, Chang TY and Li BL.
Journal Cell Res. 23 (8), 1007-1024 (2013)
Title Quantitative proteomics reveals that enzymes of the ketogenic pathway are associated with prostate cancer progression .
Author Saraon P, Cretu D, Musrap N, Karagiannis GS, Batruch I, Drabovich AP, van der Kwast T, Mizokami A, Morrissey C, Jarvi K and Diamandis EP.
Journal Mol. Cell Proteomics 12 (6), 1589-1601 (2013)
Title The Organic Acidemias: An Overview .
Author Seashore,M.R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Molecular basis of 3-ketothiolase deficiency: identification of an .
Author Fukao T, Yamaguchi S, Orii T, Osumi T and Hashimoto T.
Journal Biochim. Biophys. Acta 1139 (3), 184-188 (1992)
Title Identification of three mutant alleles of the gene for mitochondrial acetoacetyl-coenzyme A thiolase. A complete analysis of two generations of a family with 3-ketothiolase deficiency .
Author Fukao T, Yamaguchi S, Orii T, Schutgens RB, Osumi T and Hashimoto T.
Journal J. Clin. Invest. 89 (2), 474-479 (1992)
Title Chromosome mapping of the human mitochondrial acetoacetyl-coenzyme .
Author Masuno M, Kano M, Fukao T, Yamaguchi S, Osumi T, Hashimoto T, Takahashi E, Hori T and Orii T.
Journal Cytogenet. Cell Genet. 60 (2), 121-122 (1992)
Title Structure and expression of the human mitochondrial acetoacetyl-CoA thiolase-encoding gene .
Author Kano M, Fukao T, Yamaguchi S, Orii T, Osumi T and Hashimoto T.
Journal Gene 109 (2), 285-290 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.