• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens angiotensinogen (serpin peptidase inhibitor, clade A, member 8) (AGT), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000029 Homo sapiens angiotensinogen (serpin peptidase inhibitor, clade A, member 8) (AGT), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_000029.3, 188595658
Length 2587 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens angiotensinogen (serpin peptidase inhibitor, clade A, member 8) (AGT), mRNA.
Product angiotensinogen preproprotein
Comment

Summary: The protein encoded by this gene, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease. [provided by RefSeq, Jul 2008].

RefSeq NP_000020.1
CDS 509..1966
Misc Feature(1)455..457
Misc Feature(2)626..628
Misc Feature(3)626..628
Misc Feature(4)629..631
Misc Feature(5)629..631
Misc Feature(6)632..634
Misc Feature(7)647..649
Misc Feature(8)821..1951
Misc Feature(9)1016..1018
Misc Feature(10)1418..1420
Misc Feature(11)1490..1492
Exon (1)1..505
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Exon (2)506..1364
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Exon (3)1365..1632
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Exon (4)1633..1777
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Exon (5)1778..2584
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Translation MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG KPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD FTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT FQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN PLSTA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-dbSNP:
complement(3)-t, cdbSNP:386467459
3+c, tdbSNP:61757164
complement(86)-g, adbSNP:5047
complement(109)-g, adbSNP:36218431
189+c, tdbSNP:61757165
211+a, gdbSNP:5048
complement(218)-t, cdbSNP:376100632
254+a, gdbSNP:5049
complement(287)-t, cdbSNP:61762543
306+c, tdbSNP:149429444
319+a, gdbSNP:11568020
complement(319)-g, adbSNP:386519409
383+c, tdbSNP:61757166
448+a, gdbSNP:312262681
complement(451)-t, gdbSNP:5050
453+c, tdbSNP:1800585
complement(465)-t, cdbSNP:5051
480+c, tdbSNP:5052
503+a, gdbSNP:11557880
complement(513)-t, cdbSNP:61731498
complement(518)-g, adbSNP:370535384
complement(519)-g, cdbSNP:61762541
532+c, tdbSNP:207482231
536+a, tdbSNP:199476082
547+c, tdbSNP:61757171
complement(548)-t, cdbSNP:377164467
complement(556)-g, adbSNP:141762950
566+a, cdbSNP:13306155
complement(594)-t, cdbSNP:143545998
complement(600)-g, cdbSNP:149973083
complement(625)-g, adbSNP:376189338
complement(635)-g, adbSNP:41271499
complement(637)-g, adbSNP:370335267
complement(638)-t, cdbSNP:146773738
complement(654)-t, cdbSNP:377047370
complement(656)-t, adbSNP:201777691
complement(659)-g, adbSNP:61731497
complement(665)-t, cdbSNP:5039
complement(665)-t, cdbSNP:386597436
complement(692)-t, gdbSNP:142417928
complement(698)-c, adbSNP:374540090
complement(709)-g, cdbSNP:369750944
complement(720)-g, adbSNP:112711075
complement(728)-g, cdbSNP:141724549
complement(729)-g, adbSNP:201569036
complement(756)-g, adbSNP:140901725
complement(759)-g, adbSNP:61762540
complement(781)-t, cdbSNP:11568052
799+a, c, tdbSNP:11557884
complement(799)-g, adbSNP:386519286
complement(800)-g, adbSNP:11568032
complement(800)-g, adbSNP:386519410
806+a, gdbSNP:11557882
complement(813)-t, cdbSNP:200223350
complement(818)-t, cdbSNP:201406560
complement(818)-, cdbSNP:139513443
837+c, tdbSNP:11557881
838+c, tdbSNP:5040
complement(845)-g, adbSNP:374118996
848+g, tdbSNP:2229389
complement(848)-c, adbSNP:386561718
complement(854)-g, adbSNP:147355405
complement(858)-c, adbSNP:199864970
complement(875)-t, cdbSNP:149236456
complement(886)-g, adbSNP:143232180
complement(887)-t, cdbSNP:369425934
complement(904)-g, adbSNP:201189192
complement(908)-g, adbSNP:376049907
910+c, tdbSNP:11557885
913+a, cdbSNP:11557886
complement(917)-t, cdbSNP:138340265
complement(918)-g, adbSNP:34829218
complement(920)-c, adbSNP:61762539
complement(923)-g, cdbSNP:144347709
complement(938)-t, cdbSNP:138660113
complement(960)-c, adbSNP:150161533
complement(972)-g, adbSNP:143437550
975+a, gdbSNP:61757173
1039+a, gdbSNP:61757174
complement(1048)-g, adbSNP:368282573
1065+c, tdbSNP:61757175
complement(1071)-t, adbSNP:367753353
complement(1109)-t, cdbSNP:138015904
1112+c, tdbSNP:121912702
1125+c, tdbSNP:11557883
1128+c, tdbSNP:4762
complement(1164)-t, adbSNP:141302625
complement(1173)-t, g, adbSNP:146566988
complement(1191)-t, gdbSNP:143666867
complement(1204)-g, adbSNP:56010258
complement(1217)-g, adbSNP:61762537
complement(1218)-c, adbSNP:145882750
complement(1219)-g, adbSNP:200634705
complement(1238)-g, adbSNP:374685064
complement(1239)-t, gdbSNP:5041
complement(1239)-c, adbSNP:386597441
complement(1245)-g, adbSNP:372240722
complement(1251)-g, adbSNP:140964843
complement(1289)-g, adbSNP:368513901
complement(1298)-t, cdbSNP:147721058
complement(1311)-t, cdbSNP:386606420
1312+a, gdbSNP:11568053
1315..1316+ag, gtdbSNP:141900991
complement(1333)-g, adbSNP:148446907
complement(1350)-t, cdbSNP:56073403
complement(1352)-t, cdbSNP:374407232
complement(1384)-dbSNP:
complement(1384)-g, adbSNP:370412389
complement(1391)-c, adbSNP:377397992
complement(1393)-g, adbSNP:143351998
complement(1394)-t, cdbSNP:139685563
complement(1396)-t, cdbSNP:61762531
complement(1397)-g, adbSNP:61762530
complement(1410)-t, cdbSNP:140773856
complement(1420)-t, cdbSNP:61757178
complement(1422)-t, cdbSNP:200008829
complement(1428)-g, adbSNP:151246535
complement(1429)-t, gdbSNP:200945788
complement(1436)-g, cdbSNP:201352496
complement(1472)-g, adbSNP:377724135
complement(1487)-g, cdbSNP:151194891
complement(1507)-t, cdbSNP:150700257
complement(1511)-g, adbSNP:17856352
complement(1524)-t, cdbSNP:142892394
complement(1525)-g, adbSNP:186671238
complement(1526)-t, cdbSNP:143215026
complement(1531)-t, cdbSNP:11568041
complement(1540)-t, cdbSNP:147328386
complement(1542)-c, adbSNP:147736976
complement(1546)-c, adbSNP:369727853
complement(1548)-g, adbSNP:201501261
complement(1558)-g, cdbSNP:376668080
complement(1562)-t, cdbSNP:150452789
complement(1565)-g, cdbSNP:61762529
1614+a, tdbSNP:4932
1624+a, c, gdbSNP:7080
complement(1624)-g, adbSNP:386567962
complement(1631)-g, adbSNP:201162475
1632+a, gdbSNP:74315283
complement(1650)-dbSNP:
complement(1650)-c, adbSNP:137858911
complement(1652)-g, cdbSNP:61762527
complement(1660)-t, cdbSNP:113943893
complement(1662)-t, cdbSNP:386440354
complement(1662)-g, adbSNP:61731499
complement(1682)-c, adbSNP:1805090
1697+a, g, tdbSNP:61751065
complement(1700)-g, adbSNP:144678492
complement(1714)-g, adbSNP:368537638
complement(1715)-t, cdbSNP:147243938
complement(1734)-g, adbSNP:199817559
1751+a, gdbSNP:61751066
complement(1760)-g, adbSNP:200712921
1769+a, gdbSNP:61751067
1798+dbSNP:
1798+, tdbSNP:387906578
complement(1807)-t, cdbSNP:374998292
1809+c, tdbSNP:61751076
complement(1831)-g, cdbSNP:200657291
1833+c, tdbSNP:61751077
1853+c, tdbSNP:61751078
complement(1880)-g, adbSNP:375261929
complement(1900)-t, cdbSNP:377754608
complement(1903)-g, adbSNP:371051808
complement(1912)-g, adbSNP:137904474
complement(1931)-g, adbSNP:139076791
complement(1937)-g, adbSNP:267598410
complement(1938)-t, cdbSNP:146284519
complement(1945)-g, cdbSNP:200208333
complement(1950)-g, adbSNP:143479528
complement(1999)-c, adbSNP:61762526
complement(2000)-g, cdbSNP:201815901
complement(2006)-t, cdbSNP:5042
2056+c, tdbSNP:207482232
complement(2124)-g, cdbSNP:4753
2125+a, gdbSNP:61751079
complement(2133)-t, cdbSNP:386597450
2133+c, tdbSNP:5043
2134+a, tdbSNP:61751080
2150+c, tdbSNP:11684
2153+g, tdbSNP:1803103
2154+g, tdbSNP:15022
complement(2177)-g, adbSNP:371105256
2282+a, gdbSNP:1803104
complement(2284)-g, adbSNP:112670184
2304+a, cdbSNP:1803106
2316+c, tdbSNP:61751081
complement(2378)-t, adbSNP:113630741
complement(2379)-t, adbSNP:111933694
complement(2381)-c, adbSNP:147825478
complement(2389)-t, gdbSNP:5044
complement(2389)-c, adbSNP:386597452
complement(2439)-g, adbSNP:61762525
2522+a, cdbSNP:7079
complement(2539)-, gdbSNP:397766677
complement(2541)-, gdbSNP:55720804
Gene SymbolAGT
Gene SynonymANHU; SERPINA8
Chromosome1
Locus Map1q42.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000029 Homo sapiens angiotensinogen (serpin peptidase inhibitor, clade A, member 8) (AGT), mRNA. On-demand $699.00 18
Title Revising angiotensinogen from phylogenetic and genetic variants perspectives .
Author Kumar A, Sarde SJ and Bhandari A.
Journal Biochem. Biophys. Res. Commun. 446 (2), 504-518 (2014)
Title Dynamic CCAAT/enhancer binding protein-associated changes of DNA methylation in the angiotensinogen gene .
Author Wang F, Demura M, Cheng Y, Zhu A, Karashima S, Yoneda T, Demura Y, Maeda Y, Namiki M, Ono K, Nakamura Y, Sasano H, Akagi T, Yamagishi M, Saijoh K and Takeda Y.
Journal Hypertension 63 (2), 281-288 (2014)
Title An introduction of genetics in otosclerosis: a systematic review .
Author Bittermann AJ, Wegner I, Noordman BJ, Vincent R, van der Heijden GJ and Grolman W.
Journal Otolaryngol Head Neck Surg 150 (1), 34-39 (2014)
Title Correlation analysis of angiotensin-converting enzyme, angiotensinogen, and endothelial nitric oxide synthase gene polymorphisms and the progression of immunoglobulin A nephropathy/membranous nephropathy .
Author Zhu X, Kong D, Zhang L, Sun Y, Na S, Han C and Jin X.
Journal Hum. Pathol. 44 (12), 2806-2813 (2013)
Title Update of the human and mouse SERPIN gene superfamily .
Author Heit C, Jackson BC, McAndrews M, Wright MW, Thompson DC, Silverman GA, Nebert DW and Vasiliou V.
Journal Hum. Genomics 7, 22 (2013)
Title Molecular basis of human hypertension: role of angiotensinogen .
Author Jeunemaitre X, Soubrier F, Kotelevtsev YV, Lifton RP, Williams CS, Charru A, Hunt SC, Hopkins PN, Williams RR and Lalouel JM.
Journal Cell 71 (1), 169-180 (1992)
Title Cloning, expression, and characterization of a gene encoding the human angiotensin II type 1A receptor .
Author Mauzy CA, Hwang O, Egloff AM, Wu LH and Chung FZ.
Journal Biochem. Biophys. Res. Commun. 186 (1), 277-284 (1992)
Title Purification and properties of prolylcarboxypeptidase (angiotensinase C) from human kidney .
Author Odya,C.E., Marinkovic,D.V., Hammon,K.J., Stewart,T.A. and Erdos,E.G.
Journal J. Biol. Chem. 253 (17), 5927-5931 (1978)
Title Post-proline cleaving enzyme. Purification of this endopeptidase by affinity chromatography .
Author Koida,M. and Walter,R.
Journal J. Biol. Chem. 251 (23), 7593-7599 (1976)
Title Angiotensin III: (DES-Aspartic Acid-1)-Angiotensin II. Evidence and speculation for its role as an important agonist in the renin - angiotensin system .
Author Goodfriend,T.L. and Peach,M.J.
Journal Circ. Res. 36 (6 SUPPL 1), 38-48 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.