• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens angiotensinogen (serpin peptidase inhibitor, clade A, member 8) (AGT), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000029 Homo sapiens angiotensinogen (serpin peptidase inhibitor, clade A, member 8) (AGT), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_000029.3, 188595658
Length 2587 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens angiotensinogen (serpin peptidase inhibitor, clade A, member 8) (AGT), mRNA.
Product angiotensinogen preproprotein
Comment

Summary: The protein encoded by this gene, pre-angiotensinogen or angiotensinogen precursor, is expressed in the liver and is cleaved by the enzyme renin in response to lowered blood pressure. The resulting product, angiotensin I, is then cleaved by angiotensin converting enzyme (ACE) to generate the physiologically active enzyme angiotensin II. The protein is involved in maintaining blood pressure and in the pathogenesis of essential hypertension and preeclampsia. Mutations in this gene are associated with susceptibility to essential hypertension, and can cause renal tubular dysgenesis, a severe disorder of renal tubular development. Defects in this gene have also been associated with non-familial structural atrial fibrillation, and inflammatory bowel disease. [provided by RefSeq, Jul 2008].

RefSeq NP_000020.1
CDS 509..1966
Misc Feature(1)455..457
Misc Feature(2)626..628
Misc Feature(3)626..628
Misc Feature(4)629..631
Misc Feature(5)629..631
Misc Feature(6)632..634
Misc Feature(7)647..649
Misc Feature(8)821..1951
Misc Feature(9)1016..1018
Misc Feature(10)1418..1420
Misc Feature(11)1490..1492
Exon (1)1..505
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Exon (2)506..1364
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Exon (3)1365..1632
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Exon (4)1633..1777
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Exon (5)1778..2584
Gene:AGT
Gene Synonym:ANHU; SERPINA8
Translation MRKRAPQSEMAPAGVSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG KPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD FTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF WVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT FQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIR VGEVLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN PLSTA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-dbSNP:
complement(3)-t, cdbSNP:61757164
complement(86)-g, adbSNP:5047
complement(109)-g, adbSNP:36218431
complement(189)-t, cdbSNP:61757165
complement(211)-g, adbSNP:5048
complement(254)-g, adbSNP:5049
complement(287)-t, cdbSNP:61762543
complement(306)-t, cdbSNP:149429444
complement(319)-g, adbSNP:11568020
complement(383)-t, cdbSNP:61757166
complement(451)-t, gdbSNP:5050
complement(453)-t, cdbSNP:1800585
complement(465)-t, cdbSNP:5051
complement(480)-t, cdbSNP:5052
complement(503)-g, adbSNP:11557880
complement(513)-t, cdbSNP:61731498
complement(519)-g, cdbSNP:61762541
complement(532)-t, cdbSNP:207482231
complement(536)-t, adbSNP:199476082
complement(547)-t, cdbSNP:61757171
complement(556)-g, adbSNP:141762950
complement(566)-c, adbSNP:13306155
complement(594)-t, cdbSNP:143545998
complement(600)-g, cdbSNP:149973083
complement(635)-g, adbSNP:41271499
complement(638)-t, cdbSNP:146773738
complement(656)-t, adbSNP:201777691
complement(659)-g, adbSNP:61731497
complement(665)-t, cdbSNP:5039
complement(692)-t, gdbSNP:142417928
complement(720)-g, adbSNP:112711075
complement(728)-g, cdbSNP:141724549
complement(729)-g, adbSNP:201569036
complement(756)-g, adbSNP:140901725
complement(759)-g, adbSNP:61762540
complement(781)-t, cdbSNP:11568052
complement(799)-t, c, adbSNP:11557884
complement(800)-g, adbSNP:11568032
complement(806)-g, adbSNP:11557882
complement(813)-t, cdbSNP:200223350
complement(818)-t, cdbSNP:201406560
complement(818)-, cdbSNP:139513443
complement(837)-t, cdbSNP:11557881
complement(838)-t, cdbSNP:5040
complement(848)-t, gdbSNP:2229389
complement(854)-g, adbSNP:147355405
complement(858)-c, adbSNP:199864970
complement(875)-t, cdbSNP:149236456
complement(886)-g, adbSNP:143232180
complement(904)-g, adbSNP:201189192
complement(910)-t, cdbSNP:11557885
complement(913)-c, adbSNP:11557886
complement(917)-t, cdbSNP:138340265
complement(918)-g, adbSNP:34829218
complement(920)-c, adbSNP:61762539
complement(923)-g, cdbSNP:144347709
complement(938)-t, cdbSNP:138660113
complement(960)-c, adbSNP:150161533
complement(972)-g, adbSNP:143437550
complement(975)-g, adbSNP:61757173
complement(1039)-g, adbSNP:61757174
complement(1065)-t, cdbSNP:61757175
complement(1109)-t, cdbSNP:138015904
complement(1112)-t, cdbSNP:121912702
complement(1125)-t, cdbSNP:11557883
complement(1128)-t, cdbSNP:4762
complement(1164)-t, adbSNP:141302625
complement(1173)-t, g, adbSNP:146566988
complement(1191)-t, gdbSNP:143666867
complement(1204)-g, adbSNP:56010258
complement(1217)-g, adbSNP:61762537
complement(1218)-c, adbSNP:145882750
complement(1219)-g, adbSNP:200634705
complement(1239)-t, gdbSNP:5041
complement(1251)-g, adbSNP:140964843
complement(1298)-t, cdbSNP:147721058
complement(1311)-t, cdbSNP:699
complement(1312)-g, adbSNP:11568053
complement(1315..1316)-gt, agdbSNP:141900991
complement(1333)-g, adbSNP:148446907
complement(1350)-t, cdbSNP:56073403
complement(1393)-dbSNP:
complement(1393)-g, adbSNP:143351998
complement(1394)-t, cdbSNP:139685563
complement(1396)-t, cdbSNP:61762531
complement(1397)-g, adbSNP:61762530
complement(1410)-t, cdbSNP:140773856
complement(1420)-t, cdbSNP:61757178
complement(1422)-t, cdbSNP:200008829
complement(1428)-g, adbSNP:151246535
complement(1429)-t, gdbSNP:200945788
complement(1436)-g, cdbSNP:201352496
complement(1487)-g, cdbSNP:151194891
complement(1507)-t, cdbSNP:150700257
complement(1511)-g, adbSNP:17856352
complement(1524)-t, cdbSNP:142892394
complement(1525)-g, adbSNP:186671238
complement(1526)-t, cdbSNP:143215026
complement(1531)-t, cdbSNP:11568041
complement(1540)-t, cdbSNP:147328386
complement(1542)-c, adbSNP:147736976
complement(1548)-g, adbSNP:201501261
complement(1562)-t, cdbSNP:150452789
complement(1565)-g, cdbSNP:61762529
complement(1614)-t, adbSNP:4932
complement(1622)-g, cdbSNP:1803105
complement(1624)-g, c, adbSNP:7080
complement(1631)-g, adbSNP:201162475
complement(1632)-g, adbSNP:74315283
complement(1650)-dbSNP:
complement(1650)-c, adbSNP:137858911
complement(1652)-g, cdbSNP:61762527
complement(1660)-t, cdbSNP:113943893
complement(1662)-g, adbSNP:61731499
complement(1682)-c, adbSNP:1805090
complement(1697)-t, g, adbSNP:61751065
complement(1700)-g, adbSNP:144678492
complement(1715)-t, cdbSNP:147243938
complement(1734)-g, adbSNP:199817559
complement(1751)-g, adbSNP:61751066
complement(1760)-g, adbSNP:200712921
complement(1769)-g, adbSNP:61751067
complement(1809)-dbSNP:
complement(1809)-t, cdbSNP:61751076
complement(1831)-g, cdbSNP:200657291
complement(1833)-t, cdbSNP:61751077
complement(1853)-t, cdbSNP:61751078
complement(1912)-g, adbSNP:137904474
complement(1931)-g, adbSNP:139076791
complement(1938)-t, cdbSNP:146284519
complement(1945)-g, cdbSNP:200208333
complement(1950)-g, adbSNP:143479528
complement(1999)-c, adbSNP:61762526
complement(2000)-g, cdbSNP:201815901
complement(2006)-t, cdbSNP:5042
complement(2056)-t, cdbSNP:207482232
complement(2124)-g, cdbSNP:4753
complement(2125)-g, adbSNP:61751079
complement(2133)-t, cdbSNP:5043
complement(2134)-t, adbSNP:61751080
complement(2150)-t, cdbSNP:11684
complement(2153)-t, gdbSNP:1803103
complement(2154)-t, gdbSNP:15022
complement(2282)-g, adbSNP:1803104
complement(2284)-g, adbSNP:112670184
complement(2304)-c, adbSNP:1803106
complement(2316)-t, cdbSNP:61751081
complement(2378)-t, adbSNP:113630741
complement(2379)-t, adbSNP:111933694
complement(2381)-c, adbSNP:147825478
complement(2389)-t, gdbSNP:5044
complement(2439)-g, adbSNP:61762525
complement(2522)-c, adbSNP:7079
complement(2541)-, gdbSNP:55720804
Gene SymbolAGT
Gene SynonymANHU; SERPINA8
Chromosome1
Locus Map1q42.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000029 Homo sapiens angiotensinogen (serpin peptidase inhibitor, clade A, member 8) (AGT), mRNA. On-demand $699.00 18
Title Formation of high-molecular-weight angiotensinogen during pregnancy is a result of competing redox reactions with the proform of eosinophil major basic protein .
Author Kloverpris,S., Skov,L.L., Glerup,S., Pihl,K., Christiansen,M. and Oxvig,C.
Journal Biochem. J. 449 (1), 209-217 (2013)
Title Angiotensinogen gene M235T polymorphism and risk of coronary artery disease: a meta-analysis .
Author Wang,Y.J. and Pan,Y.
Journal Mol Med Rep 6 (4), 884-888 (2012)
Title Association of AGT M235T and ACE I/D polymorphisms with the risk of ischemic stroke: meta-analysis in Han Chinese population .
Author Wang,B., Guo,Q., Peng,Y., Lu,J., Singh,B. and Hua,B.
Journal J. Neurol. Sci. 320 (1-2), 79-84 (2012)
Title Angiotensinogen gene M235T and T174M polymorphisms and susceptibility of pre-eclampsia: a meta-analysis .
Author Lin,R., Lei,Y., Yuan,Z., Ju,H. and Li,D.
Journal Ann. Hum. Genet. 76 (5), 377-386 (2012)
Title Association of angiotensinogen (M235T) gene polymorphism with blood pressure lowering response to angiotensin converting enzyme inhibitor (Enalapril) .
Author Srivastava,K., Chandra,S., Bhatia,J., Narang,R. and Saluja,D.
Journal J Pharm Pharm Sci 15 (3), 399-406 (2012)
Title Molecular basis of human hypertension: role of angiotensinogen .
Author Jeunemaitre,X., Soubrier,F., Kotelevtsev,Y.V., Lifton,R.P., Williams,C.S., Charru,A., Hunt,S.C., Hopkins,P.N., Williams,R.R., Lalouel,J.M. et al.
Journal Cell 71 (1), 169-180 (1992)
Title Cloning, expression, and characterization of a gene encoding the human angiotensin II type 1A receptor .
Author Mauzy,C.A., Hwang,O., Egloff,A.M., Wu,L.H. and Chung,F.Z.
Journal Biochem. Biophys. Res. Commun. 186 (1), 277-284 (1992)
Title Purification and properties of prolylcarboxypeptidase (angiotensinase C) from human kidney .
Author Odya,C.E., Marinkovic,D.V., Hammon,K.J., Stewart,T.A. and Erdos,E.G.
Journal J. Biol. Chem. 253 (17), 5927-5931 (1978)
Title Post-proline cleaving enzyme. Purification of this endopeptidase by affinity chromatography .
Author Koida,M. and Walter,R.
Journal J. Biol. Chem. 251 (23), 7593-7599 (1976)
Title Angiotensin III: (DES-Aspartic Acid-1)-Angiotensin II. Evidence and speculation for its role as an important agonist in the renin - angiotensin system .
Author Goodfriend,T.L. and Peach,M.J.
Journal Circ. Res. 36 (6 SUPPL 1), 38-48 (1975)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.