• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens aldolase B, fructose-bisphosphate (ALDOB), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18947 Homo sapiens aldolase B, fructose-bisphosphate (ALDOB), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu18947C Homo sapiens aldolase B, fructose-bisphosphate (ALDOB), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000035.3, 218505812
Length 1095 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens aldolase B, fructose-bisphosphate (ALDOB), mRNA.
Product fructose-bisphosphate aldolase B
Comment

Summary: Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance. [provided by RefSeq, Dec 2008].

RefSeq NP_000026.2
CDS 83..1177
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)41..43
Misc Feature(4)119..1111
Misc Feature(5)119..1111
Misc Feature(6)order(182..190,197..199,404..406,521..523,527..529,
Misc Feature(7)order(413..415,566..568,575..580,587..589,599..601,
Misc Feature(8)770..772
Misc Feature(9)1172..1174
Exon (1)1..72
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (2)73..194
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (3)195..406
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (4)407..461
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (5)462..622
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (6)623..706
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (7)707..881
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (8)882..1081
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (9)1082..2426
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Translation MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR EILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTN KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQ NGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF SYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTA CYTY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(25)-g, cdbSNP:145578385
complement(65)-g, adbSNP:484567
complement(67)-t, gdbSNP:375538366
92+c, tdbSNP:118204428
complement(112)-t, cdbSNP:376852683
complement(116)-g, cdbSNP:190631679
complement(159)-t, cdbSNP:186949752
complement(184)-t, adbSNP:181247220
complement(201)-dbSNP:
complement(201)-g, c, adbSNP:77849749
complement(218)-t, adbSNP:41281039
complement(219)-t, cdbSNP:199920124
complement(238)-c, adbSNP:149671008
244+c, gdbSNP:2854709
complement(248)-g, adbSNP:201397971
complement(249)-c, adbSNP:200050226
complement(252)-t, cdbSNP:370761101
260+c, tdbSNP:118204429
complement(261)-t, cdbSNP:141267935
complement(273)-c, adbSNP:151219186
complement(306)-g, cdbSNP:375679562
complement(325)-g, adbSNP:182003715
complement(346)-g, adbSNP:200585150
complement(370)-g, adbSNP:372738117
complement(375)-g, adbSNP:200121991
complement(400)-t, cdbSNP:142196987
complement(416)-dbSNP:
complement(416)-t, cdbSNP:373330514
complement(423)-g, adbSNP:201694645
complement(434)-t, cdbSNP:200382297
439..442+, aaacdbSNP:387906225
complement(447)-t, cdbSNP:149112046
complement(471)-dbSNP:
complement(471)-g, cdbSNP:199981226
complement(482)-t, gdbSNP:10123355
complement(483)-t, cdbSNP:145252200
524+c, tdbSNP:118204430
complement(527)-g, adbSNP:190464963
complement(528)-t, cdbSNP:201740217
complement(569)-g, cdbSNP:17852652
complement(570)-g, adbSNP:202210810
complement(583)-g, adbSNP:186836225
complement(585)-g, adbSNP:370367583
complement(606)-t, gdbSNP:76917243
complement(607)-g, adbSNP:144196914
complement(611)-t, cdbSNP:139442303
complement(625)-dbSNP:
complement(625)-c, adbSNP:35885472
629..634+, ctggtadbSNP:387906226
complement(642)-g, adbSNP:188851404
complement(664)-g, adbSNP:141988626
complement(672)-t, cdbSNP:368140282
complement(692)-c, adbSNP:374240733
complement(694)-t, adbSNP:370793608
complement(696)-t, adbSNP:376375686
complement(701)-g, cdbSNP:3739721
728+dbSNP:
728+a, gdbSNP:1803086
complement(754)-t, cdbSNP:202031050
complement(756)-t, cdbSNP:200102975
complement(762)-g, adbSNP:371219301
complement(763)-g, adbSNP:61757689
complement(772)-t, cdbSNP:376978142
802+a, cdbSNP:118204426
complement(830)-c, adbSNP:41281035
complement(832)-t, adbSNP:150644101
complement(841)-t, g, adbSNP:146360505
complement(848)-c, adbSNP:201551409
complement(857)-g, adbSNP:201424676
complement(885)-dbSNP:
complement(885)-t, adbSNP:10989495
complement(917)-t, cdbSNP:142177161
complement(925)-g, adbSNP:17852653
complement(931)-g, adbSNP:202062631
947..949+, cttdbSNP:118204425
complement(988)-g, adbSNP:138866018
complement(993)-t, cdbSNP:145078268
complement(1048)-t, cdbSNP:149166711
complement(1062)-g, adbSNP:199642880
complement(1067)-t, adbSNP:138115351
complement(1073)-g, adbSNP:150407710
complement(1074)-c, adbSNP:371526091
complement(1095)-dbSNP:
complement(1095)-t, cdbSNP:386626618
1095+c, tdbSNP:77718928
complement(1109)-g, adbSNP:369586696
complement(1136)-c, adbSNP:140864863
complement(1150)-t, cdbSNP:377173333
1151+c, gdbSNP:1803088
complement(1189)-g, adbSNP:201867948
complement(1230)-t, cdbSNP:183809646
complement(1231)-t, cdbSNP:28580764
1246+c, tdbSNP:4577
complement(1299)-t, cdbSNP:41310087
complement(1327)-, tdbSNP:200345626
complement(1329)-t, cdbSNP:192418526
complement(1336)-g, adbSNP:111401889
complement(1366)-g, adbSNP:185986022
complement(1383)-t, gdbSNP:17772869
complement(1445)-g, adbSNP:142431256
complement(1601)-t, cdbSNP:386471029
complement(1601)-g, adbSNP:148781781
complement(1621)-g, cdbSNP:144337754
complement(1682)-t, gdbSNP:17772845
complement(1687)-g, adbSNP:150017672
complement(1729)-t, adbSNP:41308902
complement(1789)-t, cdbSNP:41296049
complement(1888)-t, gdbSNP:12347519
complement(2026)-g, adbSNP:181650438
complement(2040)-g, cdbSNP:28508262
complement(2074)-t, cdbSNP:17772839
complement(2180)-t, cdbSNP:80292759
complement(2222)-t, gdbSNP:12344277
complement(2239)-t, gdbSNP:367750084
complement(2276)-c, adbSNP:190094483
complement(2296)-g, adbSNP:41296051
2328+a, c, gdbSNP:491979
Gene SymbolALDOB
Gene SynonymALDB; ALDO2
Chromosome9
Locus Map9q21.3-q22.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000035 Homo sapiens aldolase B, fructose-bisphosphate (ALDOB), mRNA. On-demand $219.00 7-9
Title Aldolase B knockdown prevents high glucose-induced methylglyoxal overproduction and cellular dysfunction in endothelial cells .
Author Liu J, Mak TC, Banigesh A, Desai K, Wang R and Wu L.
Journal PLoS ONE 7 (7), E41495 (2012)
Title Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma .
Author Chambers JC, Zhang W, Sehmi J, Li X, Wass MN, Van der Harst P, Holm H, Sanna S, Kavousi M, Baumeister SE, Coin LJ, Deng G, Gieger C, Heard-Costa NL, Hottenga JJ, Kuhnel B, Kumar V, Lagou V, Liang L, Luan J, Vidal PM, Mateo Leach I, O'Reilly PF, Peden JF, Rahmioglu N, Soininen P, Speliotes EK, Yuan X, Thorleifsson G, Alizadeh BZ, Atwood LD, Borecki IB, Brown MJ, Charoen P, Cucca F, Das D, de Geus EJ, Dixon AL, Doring A, Ehret G, Eyjolfsson GI, Farrall M, Forouhi NG, Friedrich N, Goessling W, Gudbjartsson DF, Harris TB, Hartikainen AL, Heath S, Hirschfield GM, Hofman A, Homuth G, Hypponen E, Janssen HL, Johnson T, Kangas AJ, Kema IP, Kuhn JP, Lai S, Lathrop M, Lerch MM, Li Y, Liang TJ, Lin JP, Loos RJ, Martin NG, Moffatt MF, Montgomery GW, Munroe PB, Musunuru K, Nakamura Y, O'Donnell CJ, Olafsson I, Penninx BW, Pouta A, Prins BP, Prokopenko I, Puls R, Ruokonen A, Savolainen MJ, Schlessinger D, Schouten JN, Seedorf U, Sen-Chowdhry S, Siminovitch KA, Smit JH, Spector TD, Tan W, Teslovich TM, Tukiainen T, Uitterlinden AG, Van der Klauw MM, Vasan RS, Wallace C, Wallaschofski H, Wichmann HE, Willemsen G, Wurtz P, Xu C, Yerges-Armstrong LM, Abecasis GR, Ahmadi KR, Boomsma DI, Caulfield M, Cookson WO, van Duijn CM, Froguel P, Matsuda K, McCarthy MI, Meisinger C, Mooser V, Pietilainen KH, Schumann G, Snieder H, Sternberg MJ, Stolk RP, Thomas HC, Thorsteinsdottir U, Uda M, Waeber G, Wareham NJ, Waterworth DM, Watkins H, Whitfield JB, Witteman JC, Wolffenbuttel BH, Fox CS, Ala-Korpela M, Stefansson K, Vollenweider P, Volzke H, Schadt EE, Scott J, Jarvelin MR, Elliott P and Kooner JS.
Journal Nat. Genet. 43 (11), 1131-1138 (2011)
Title Stabilization of the predominant disease-causing aldolase variant (A149P) with zwitterionic osmolytes .
Author Stopa JD, Chandani S and Tolan DR.
Journal Biochemistry 50 (5), 663-671 (2011)
Title Mutations in the promoter region of the aldolase B gene that cause hereditary fructose intolerance .
Author Coffee EM and Tolan DR.
Journal J. Inherit. Metab. Dis. 33 (6), 715-725 (2010)
Title Hereditary fructose intolerance: functional study of two novel .
Author Esposito G, Imperato MR, Ieno L, Sorvillo R, Benigno V, Parenti G, Parini R, Vitagliano L, Zagari A and Salvatore F.
Journal Hum. Mutat. 31 (12), 1294-1303 (2010)
Title A new aldolase B variant, N334K, is a common cause of hereditary fructose intolerance in Yugoslavia .
Author Cross NC, Stojanov LM and Cox TM.
Journal Nucleic Acids Res. 18 (7), 1925 (1990)
Title Molecular analysis of aldolase B genes in hereditary fructose intolerance .
Author Cross NC, de Franchis R, Sebastio G, Dazzo C, Tolan DR, Gregori C, Odievre M, Vidailhet M, Romano V and Mascali G.
Journal Lancet 335 (8685), 306-309 (1990)
Title Construction and expression of human aldolase A and B expression plasmids in Escherichia coli host .
Author Sakakibara M, Takahashi I, Takasaki Y, Mukai T and Hori K.
Journal Biochim. Biophys. Acta 1007 (3), 334-342 (1989)
Title Human aldolase B gene: characterization of the genomic aldolase B gene and analysis of sequences required for multiple polyadenylations .
Author Mukai T, Yatsuki H, Arai Y, Joh K, Matsuhashi S and Hori K.
Journal J. Biochem. 102 (5), 1043-1051 (1987)
Title Human aldolase isozyme gene: the structure of multispecies aldolase .
Author Sakakibara,M., Mukai,T., Yatsuki,H. and Hori,K.
Journal Nucleic Acids Res. 13 (14), 5055-5069 (1985)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.