• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens aldolase B, fructose-bisphosphate (ALDOB), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000035 Homo sapiens aldolase B, fructose-bisphosphate (ALDOB), mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_000035.3, 218505812
Length 2426 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens aldolase B, fructose-bisphosphate (ALDOB), mRNA.
Product fructose-bisphosphate aldolase B
Comment

Summary: Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance. [provided by RefSeq, Dec 2008].

RefSeq NP_000026.2
CDS 83..1177
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)41..43
Misc Feature(4)119..1111
Misc Feature(5)119..1111
Misc Feature(6)order(182..190,197..199,404..406,521..523,527..529,
Misc Feature(7)order(413..415,566..568,575..580,587..589,599..601,
Misc Feature(8)770..772
Misc Feature(9)1172..1174
Exon (1)1..72
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (2)73..194
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (3)195..406
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (4)407..461
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (5)462..622
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (6)623..706
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (7)707..881
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (8)882..1081
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Exon (9)1082..2426
Gene:ALDOB
Gene Synonym:ALDB; ALDO2
Translation MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR EILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTN KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQ NGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF SYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTA CYTY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(25)-g, cdbSNP:145578385
complement(65)-g, adbSNP:484567
complement(92)-t, cdbSNP:118204428
complement(116)-g, cdbSNP:190631679
complement(159)-t, cdbSNP:186949752
complement(184)-t, adbSNP:181247220
complement(201)-dbSNP:
complement(201)-c, adbSNP:77849749
complement(218)-t, adbSNP:41281039
complement(219)-t, cdbSNP:199920124
complement(238)-c, adbSNP:149671008
complement(244)-g, cdbSNP:2854709
complement(248)-g, adbSNP:201397971
complement(249)-c, adbSNP:200050226
complement(260)-t, cdbSNP:118204429
complement(261)-t, cdbSNP:141267935
complement(273)-c, adbSNP:151219186
complement(325)-g, adbSNP:182003715
complement(346)-g, adbSNP:200585150
complement(375)-g, adbSNP:200121991
complement(400)-t, cdbSNP:142196987
complement(423)-dbSNP:
complement(423)-g, adbSNP:201694645
complement(434)-t, cdbSNP:200382297
complement(447)-t, cdbSNP:149112046
complement(471)-dbSNP:
complement(471)-g, cdbSNP:199981226
complement(482)-t, gdbSNP:10123355
complement(483)-t, cdbSNP:145252200
complement(524)-t, cdbSNP:118204430
complement(527)-g, adbSNP:190464963
complement(528)-t, cdbSNP:201740217
complement(530)-g, cdbSNP:1800546
complement(569)-g, cdbSNP:17852652
complement(570)-g, adbSNP:202210810
complement(583)-g, adbSNP:186836225
complement(606)-t, gdbSNP:76917243
complement(607)-g, adbSNP:144196914
complement(611)-t, cdbSNP:139442303
complement(625)-dbSNP:
complement(625)-c, adbSNP:35885472
complement(642)-g, adbSNP:188851404
complement(664)-g, adbSNP:141988626
complement(701)-g, cdbSNP:3739721
complement(728)-dbSNP:
complement(728)-g, adbSNP:1803086
complement(754)-t, cdbSNP:202031050
complement(756)-t, cdbSNP:200102975
complement(763)-g, adbSNP:61757689
complement(802)-c, adbSNP:118204426
complement(830)-c, adbSNP:41281035
complement(832)-t, adbSNP:150644101
complement(841)-g, adbSNP:146360505
complement(848)-c, adbSNP:201551409
complement(857)-g, adbSNP:201424676
complement(885)-dbSNP:
complement(885)-t, adbSNP:10989495
complement(917)-t, cdbSNP:142177161
complement(925)-g, adbSNP:17852653
complement(931)-g, adbSNP:202062631
complement(947..949)-, cttdbSNP:118204425
complement(988)-g, adbSNP:138866018
complement(993)-t, cdbSNP:145078268
complement(1048)-t, cdbSNP:149166711
complement(1062)-g, adbSNP:199642880
complement(1067)-t, adbSNP:138115351
complement(1073)-g, adbSNP:150407710
complement(1087)-dbSNP:
complement(1087)-g, cdbSNP:78340951
complement(1095)-t, cdbSNP:77718928
complement(1136)-c, adbSNP:140864863
complement(1151)-g, cdbSNP:1803088
complement(1189)-g, adbSNP:201867948
complement(1230)-t, cdbSNP:183809646
complement(1231)-t, cdbSNP:28580764
complement(1246)-t, cdbSNP:4577
complement(1299)-t, cdbSNP:41310087
complement(1327)-, tdbSNP:200345626
complement(1329)-t, cdbSNP:192418526
complement(1336)-g, adbSNP:111401889
complement(1366)-g, adbSNP:185986022
complement(1383)-t, gdbSNP:17772869
complement(1445)-g, adbSNP:142431256
complement(1601)-g, adbSNP:148781781
complement(1621)-g, cdbSNP:144337754
complement(1682)-t, gdbSNP:17772845
complement(1687)-g, adbSNP:150017672
complement(1729)-t, adbSNP:41308902
complement(1789)-t, cdbSNP:41296049
complement(1888)-t, gdbSNP:12347519
complement(2026)-g, adbSNP:181650438
complement(2040)-g, cdbSNP:28508262
complement(2074)-t, cdbSNP:17772839
complement(2180)-t, cdbSNP:80292759
complement(2222)-t, gdbSNP:12344277
complement(2276)-c, adbSNP:190094483
complement(2296)-g, adbSNP:41296051
complement(2328)-g, c, adbSNP:491979
Gene SymbolALDOB
Gene SynonymALDB; ALDO2
Chromosome9
Locus Map9q21.3-q22.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000035 Homo sapiens aldolase B, fructose-bisphosphate (ALDOB), mRNA. On-demand $549.00 14
Title Aldolase B knockdown prevents high glucose-induced methylglyoxal overproduction and cellular dysfunction in endothelial cells .
Author Liu,J., Mak,T.C., Banigesh,A., Desai,K., Wang,R. and Wu,L.
Journal PLoS ONE 7 (7), E41495 (2012)
Title Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma .
Author Chambers,J.C., Zhang,W., Sehmi,J., Li,X., Wass,M.N., Van der Harst,P., Holm,H., Sanna,S., Kavousi,M., Baumeister,S.E., Coin,L.J., Deng,G., Gieger,C., Heard-Costa,N.L., Hottenga,J.J., Kuhnel,B., Kumar,V., Lagou,V., Liang,L., Luan,J., Vidal,P.M., Mateo Leach,I., O'Reilly,P.F., Peden,J.F., Rahmioglu,N., Soininen,P., Speliotes,E.K., Yuan,X., Thorleifsson,G., Alizadeh,B.Z., Atwood,L.D., Borecki,I.B., Brown,M.J., Charoen,P., Cucca,F., Das,D., de Geus,E.J., Dixon,A.L., Doring,A., Ehret,G., Eyjolfsson,G.I., Farrall,M., Forouhi,N.G., Friedrich,N., Goessling,W., Gudbjartsson,D.F., Harris,T.B., Hartikainen,A.L., Heath,S., Hirschfield,G.M., Hofman,A., Homuth,G., Hypponen,E., Janssen,H.L., Johnson,T., Kangas,A.J., Kema,I.P., Kuhn,J.P., Lai,S., Lathrop,M., Lerch,M.M., Li,Y., Liang,T.J., Lin,J.P., Loos,R.J., Martin,N.G., Moffatt,M.F., Montgomery,G.W., Munroe,P.B., Musunuru,K., Nakamura,Y., O'Donnell,C.J., Olafsson,I., Penninx,B.W., Pouta,A., Prins,B.P., Prokopenko,I., Puls,R., Ruokonen,A., Savolainen,M.J., Schlessinger,D., Schouten,J.N., Seedorf,U., Sen-Chowdhry,S., Siminovitch,K.A., Smit,J.H., Spector,T.D., Tan,W., Teslovich,T.M., Tukiainen,T., Uitterlinden,A.G., Van der Klauw,M.M., Vasan,R.S., Wallace,C., Wallaschofski,H., Wichmann,H.E., Willemsen,G., Wurtz,P., Xu,C., Yerges-Armstrong,L.M., Abecasis,G.R., Ahmadi,K.R., Boomsma,D.I., Caulfield,M., Cookson,W.O., van Duijn,C.M., Froguel,P., Matsuda,K., McCarthy,M.I., Meisinger,C., Mooser,V., Pietilainen,K.H., Schumann,G., Snieder,H., Sternberg,M.J., Stolk,R.P., Thomas,H.C., Thorsteinsdottir,U., Uda,M., Waeber,G., Wareham,N.J., Waterworth,D.M., Watkins,H., Whitfield,J.B., Witteman,J.C., Wolffenbuttel,B.H., Fox,C.S., Ala-Korpela,M., Stefansson,K., Vollenweider,P., Volzke,H., Schadt,E.E., Scott,J., Jarvelin,M.R., Elliott,P. and Kooner,J.S.
Journal Nat. Genet. 43 (11), 1131-1138 (2011)
Title Stabilization of the predominant disease-causing aldolase variant (A149P) with zwitterionic osmolytes .
Author Stopa,J.D., Chandani,S. and Tolan,D.R.
Journal Biochemistry 50 (5), 663-671 (2011)
Title Mutations in the promoter region of the aldolase B gene that cause hereditary fructose intolerance .
Author Coffee,E.M. and Tolan,D.R.
Journal J. Inherit. Metab. Dis. 33 (6), 715-725 (2010)
Title Hereditary fructose intolerance: functional study of two novel .
Author Esposito,G., Imperato,M.R., Ieno,L., Sorvillo,R., Benigno,V., Parenti,G., Parini,R., Vitagliano,L., Zagari,A. and Salvatore,F.
Journal Hum. Mutat. 31 (12), 1294-1303 (2010)
Title A new aldolase B variant, N334K, is a common cause of hereditary fructose intolerance in Yugoslavia .
Author Cross,N.C., Stojanov,L.M. and Cox,T.M.
Journal Nucleic Acids Res. 18 (7), 1925 (1990)
Title Molecular analysis of aldolase B genes in hereditary fructose intolerance .
Author Cross,N.C., de Franchis,R., Sebastio,G., Dazzo,C., Tolan,D.R., Gregori,C., Odievre,M., Vidailhet,M., Romano,V., Mascali,G. et al.
Journal Lancet 335 (8685), 306-309 (1990)
Title Construction and expression of human aldolase A and B expression plasmids in Escherichia coli host .
Author Sakakibara,M., Takahashi,I., Takasaki,Y., Mukai,T. and Hori,K.
Journal Biochim. Biophys. Acta 1007 (3), 334-342 (1989)
Title Human aldolase B gene: characterization of the genomic aldolase B gene and analysis of sequences required for multiple polyadenylations .
Author Mukai,T., Yatsuki,H., Arai,Y., Joh,K., Matsuhashi,S. and Hori,K.
Journal J. Biochem. 102 (5), 1043-1051 (1987)
Title Human aldolase isozyme gene: the structure of multispecies aldolase .
Author Sakakibara,M., Mukai,T., Yatsuki,H. and Hori,K.
Journal Nucleic Acids Res. 13 (14), 5055-5069 (1985)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.