• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens adenomatous polyposis coli (APC), transcript variant 3, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu16786 Homo sapiens adenomatous polyposis coli (APC), transcript variant 3, mRNA. pcDNA3.1+-DYK On-demand $4749.00 40
OHu16786C Homo sapiens adenomatous polyposis coli (APC), transcript variant 3, mRNA. Customized vector On-demand $4749.00 40

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000038.5, 307133686
Length 8532 bp
Structure linear
Update Date 20-APR-2014
Organism Homo sapiens (human)
Definition Homo sapiens adenomatous polyposis coli (APC), transcript variant 3, mRNA.
Product adenomatous polyposis coli protein isoform b
Comment

Summary: This gene encodes a tumor suppressor protein that acts as an antagonist of the Wnt signaling pathway. It is also involved in other processes including cell migration and adhesion, transcriptional activation, and apoptosis. Defects in this gene cause familial adenomatous polyposis (FAP), an autosomal dominant pre-malignant disease that usually progresses to malignancy. Disease-associated mutations tend to be clustered in a small region designated the mutation cluster region (MCR) and result in a truncated protein product. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (3) differs in the 5' UTR, lacks a portion of the 5' coding region, and initiates translation at an alternate start codon, compared to variant 1. This variant also contains an alternate in-frame exon compared to variant 1. The encoded isoform (b) has a distinct N-terminus and is longer than isoform a. Variants 2 and 3 encode the same isoform (b).

RefSeq NP_000029.2
CDS 86..8617
Misc Feature(1)77..79
Misc Feature(2)89..91
Misc Feature(3)89..91
Misc Feature(4)461..709
Misc Feature(5)1016..1324
Misc Feature(6)order(1076..1078,1088..1090,1100..1102,1184..1186,
Misc Feature(7)1442..1570
Misc Feature(8)1475..1876
Misc Feature(9)order(1580..1582,1592..1594,1604..1606,1700..1702,
Misc Feature(10)1598..1726
Misc Feature(11)1727..1858
Misc Feature(12)1859..1999
Misc Feature(13)1916..2278
Misc Feature(14)order(1982..1984,1994..1996,2006..2008,2108..2110,
Misc Feature(15)2000..2134
Misc Feature(16)2135..2260
Misc Feature(17)2249..2251
Misc Feature(18)2261..2386
Misc Feature(19)2315..2317
Misc Feature(20)2423..2425
Misc Feature(21)2963..4096
Misc Feature(22)3209..3211
Misc Feature(23)3920..3922
Misc Feature(24)4163..4165
Misc Feature(25)4190..4267
Misc Feature(26)4259..4261
Misc Feature(27)4586..4588
Misc Feature(28)4592..4594
Misc Feature(29)4595..4597
Misc Feature(30)4598..4600
Misc Feature(31)4604..4606
Misc Feature(32)4613..4615
Misc Feature(33)4991..5068
Misc Feature(34)5240..5299
Misc Feature(35)5666..5668
Misc Feature(36)5666..5668
Misc Feature(37)5672..5674
Misc Feature(38)5672..5674
Misc Feature(39)5675..5677
Misc Feature(40)5675..5677
Misc Feature(41)5681..5764
Misc Feature(42)6185..6244
Misc Feature(43)6245..6247
Misc Feature(44)6362..6364
Misc Feature(45)6536..6538
Misc Feature(46)6752..7789
Misc Feature(47)6863..6865
Misc Feature(48)6893..6895
Misc Feature(49)6932..6934
Misc Feature(50)7277..7279
Misc Feature(51)7502..7504
Misc Feature(52)7688..7690
Misc Feature(53)8093..8614
Misc Feature(54)8096..8098
Misc Feature(55)8105..8107
Misc Feature(56)8120..8122
Misc Feature(57)8450..8452
Misc Feature(58)8492..8503
Misc Feature(59)8606..8614
Exon (1)1..67
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (2)68..220
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (3)221..305
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (4)306..507
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (5)508..616
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (6)617..730
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (7)731..814
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (8)815..919
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (9)920..1018
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (10)1019..1397
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (11)1398..1493
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (12)1494..1633
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (13)1634..1711
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (14)1712..1828
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (15)1829..2043
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Exon (16)2044..10730
Gene:APC
Gene Synonym:BTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Translation MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR RGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQAT EAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQGSTTRMDHETASVLSSSSTHSA PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC WEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQ VDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDL QQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCT ENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENN CLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAM GSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLS PKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGS LDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTS QEDRSSGSTTELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSS NDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGE LDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQSEQRQSRNQSTTYPVYTE STDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHGINQNVSQSLCQEDDYEDDKP TNYSERYSEEEQHEEEERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSSQKQSFSFSKS SSGQSSKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCKVSSINQETIQ TYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTTQEADSANTLQIAEIKEKIGTRSAEDPV SEVPAVSQHPRTKSSRLQGSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQET PLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPP PPPQTAQTKREVPKNKAPTAEKRESGPKQAAVNAAVQRVQVLPDADTLLHFATESTPDGF SCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQPKESNENQEKEAEKTIDSE KDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPSQLPVYKLLPS QNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQ SGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKP FRVKKIMDQVQQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLN AERVFSDNKDSKKQNLKNNSKVFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRND SLSSLDFDDDDVDLSREKAELRKAKENKESEAKVTSHTELTSNQQSANKTQAIAKQPINR GQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTPVCFSHNSSLSSLSDIDQENN NKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLQ ECISSAMPKKKKPSRLKGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFD WKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFT SNKGPRILKPGEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQAN MPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKS ELSPVARQTSQIGGSSKAPSRSGSRDSTPSRPAQQPLSRPIQSPGRNSISPGRNGISPPN KLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQTGLSKNASSIPRSESASKG LNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSPTLRRKLEESA SFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDG RPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSES SEKAKSEDEKHVNSISGTKQSKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAES KTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDN QAKQNVGNGSVPMRTVGLENRLNSFIQVDAPDQKGTEIKPGQNNPVPVSETNESSIVERT PFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVNNNTKKRDSKT DSTESSGTQSPKRHSGSYLVTSV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
2+dbSNP:
2+g, tdbSNP:75996864
16+c, gdbSNP:115242894
70+dbSNP:
70+c, tdbSNP:371665872
99+c, tdbSNP:373718658
138+a, tdbSNP:200960071
152+c, gdbSNP:372367350
155+c, tdbSNP:145945630
205+a, gdbSNP:142720069
270+dbSNP:
270+c, tdbSNP:74727182
275+g, tdbSNP:79323615
336+dbSNP:
336+g, tdbSNP:143145868
337+a, gdbSNP:375051600
361+c, tdbSNP:369238363
362+c, gdbSNP:201567345
369+c, tdbSNP:146221748
373+c, tdbSNP:376213437
380+c, tdbSNP:139196838
381+a, gdbSNP:199842850
396+a, cdbSNP:74953290
402+a, gdbSNP:201764637
426+c, gdbSNP:200117298
431+g, tdbSNP:142637152
432+a, gdbSNP:369999291
447+a, gdbSNP:193049694
464+a, gdbSNP:200089324
470+c, gdbSNP:376628500
473+a, gdbSNP:150973053
505+c, gdbSNP:202161017
534+dbSNP:
534+a, gdbSNP:371085910
535+a, gdbSNP:116020626
555+a, gdbSNP:137854576
594..597+, atagdbSNP:387906231
595+c, tdbSNP:111875298
622..623+dbSNP:
622..623+, cdbSNP:35790168
622+a, cdbSNP:149736402
649+a, gdbSNP:377493489
658+c, tdbSNP:185154886
666+a, gdbSNP:200740020
673+c, tdbSNP:147846364
692+c, gdbSNP:141576417
707+c, tdbSNP:137854583
728+c, tdbSNP:137854577
731+dbSNP:
731+c, tdbSNP:62619935
732+a, g, tdbSNP:76685252
757+c, tdbSNP:367816013
779+c, tdbSNP:397515734
780+a, gdbSNP:201727026
790+a, gdbSNP:147036141
815..816+dbSNP:
815..816+, agdbSNP:387906228
862+g, tdbSNP:147704593
876+a, gdbSNP:369345931
924+dbSNP:
924+c, gdbSNP:137854569
933+a, gdbSNP:149154604
939+a, gdbSNP:201093383
947+a, cdbSNP:199535736
979+c, gdbSNP:143341972
981..982+, ctdbSNP:397515735
989+c, tdbSNP:137854568
1022..1023+dbSNP:
1022..1023+, gadbSNP:387906239
1078+a, gdbSNP:148343173
1080+a, gdbSNP:377665107
complement(1090)-t, cdbSNP:3797704
1106+a, cdbSNP:77058194
1154..1155+, adbSNP:387906232
1181+a, gdbSNP:199562537
1183..1184+, ctdbSNP:387906237
1197+a, gdbSNP:377351581
1199+a, gdbSNP:201478136
1206+a, gdbSNP:141582813
1243+a, gdbSNP:370669642
1277..1278+, aadbSNP:387906238
1278+a, gdbSNP:145912662
1325+c, tdbSNP:137854567
1359+a, gdbSNP:77907679
1361+g, tdbSNP:200598389
1384+a, gdbSNP:141726130
1416+dbSNP:
1416+a, gdbSNP:371065509
1427+c, gdbSNP:374195067
1454+, tdbSNP:387906229
1503+dbSNP:
1503+a, gdbSNP:190988940
1504+a, gdbSNP:141579422
1528+a, gdbSNP:146179851
1543+c, tdbSNP:2229992
1548+c, tdbSNP:368434773
1568+a, gdbSNP:372047677
1573+a, tdbSNP:9282599
1576+a, gdbSNP:201992951
1579+a, gdbSNP:199726985
1580+c, g, tdbSNP:137854580
1585+g, tdbSNP:387906230
1588+c, tdbSNP:201664378
1600+g, tdbSNP:77451514
1638+dbSNP:
1638+c, tdbSNP:371453363
1674+c, tdbSNP:202199891
1689+c, tdbSNP:75870842
1691+a, gdbSNP:138098808
1706+c, tdbSNP:137854572
1716+dbSNP:
1716+c, tdbSNP:144056494
1720+c, tdbSNP:386583324
1744+a, gdbSNP:398123116
1745+c, tdbSNP:137854573
1752+a, tdbSNP:111423620
1753+c, tdbSNP:377045570
1775+c, tdbSNP:137854574
1780+, adbSNP:397514032
1780+a, gdbSNP:77921116
1846+dbSNP:
1846+c, tdbSNP:370783137
1847+a, gdbSNP:372416031
1896+c, gdbSNP:370955311
1910+a, gdbSNP:147863331
1948+c, tdbSNP:72541808
1970..1971+, adbSNP:387906233
1993+g, tdbSNP:79015778
1997+a, gdbSNP:75117039
2002..2003+, adbSNP:397515732
2012+c, tdbSNP:78349383
2044+dbSNP:
2044+a, gdbSNP:72541809
2098+g, tdbSNP:145356265
2178+a, tdbSNP:137854582
2185+c, tdbSNP:376487701
2195+a, gdbSNP:367804502
2223+c, gdbSNP:137854570
2239+a, tdbSNP:372725652
2272+c, tdbSNP:376015279
2289+a, c, tdbSNP:147655929
2290+a, gdbSNP:141001261
2307+a, gdbSNP:150209825
2317+g, tdbSNP:145751759
2335+a, tdbSNP:376526724
2347+g, tdbSNP:148987776
2382+c, tdbSNP:200339830
2395+a, gdbSNP:201019009
2407+c, tdbSNP:145792879
2420+c, tdbSNP:369138788
2450+c, tdbSNP:398123117
2470+c, tdbSNP:80188155
2471+g, tdbSNP:77985571
2489+g, tdbSNP:79853077
2499+a, gdbSNP:200593940
2503+a, tdbSNP:372917037
2523+a, gdbSNP:201522866
2546+a, gdbSNP:138498551
2559+a, gdbSNP:186641437
2561+g, tdbSNP:145245264
2594+g, tdbSNP:79634147
2595+a, c, gdbSNP:79512956
2596+a, gdbSNP:79909810
2632..2635+, tagadbSNP:398123118
2671+c, gdbSNP:147972247
2678+c, tdbSNP:192620988
2685+a, cdbSNP:374813438
2693+c, tdbSNP:33974176
2698+a, cdbSNP:36046448
2711+c, tdbSNP:121913333
2712+a, gdbSNP:373428732
2725+c, tdbSNP:200184105
2762+a, gdbSNP:199740875
2816+g, tdbSNP:398123119
2849+c, tdbSNP:150543576
2863+c, tdbSNP:371526966
2890+a, c, tdbSNP:137854575
2890+, cdbSNP:398123120
2923+a, gdbSNP:142835322
2932+g, tdbSNP:147394539
3005+g, tdbSNP:74561014
3028+a, cdbSNP:148153867
3030+c, tdbSNP:139773221
3031+a, gdbSNP:377384463
3033+c, tdbSNP:113674464
3080+a, cdbSNP:75239284
3091+c, tdbSNP:72541810
3158+a, gdbSNP:370591349
3247+, cdbSNP:397515733
3250+a, tdbSNP:61734287
3258+a, gdbSNP:148725540
3284+c, tdbSNP:137854571
3290+a, gdbSNP:375408871
3317+c, tdbSNP:367687901
3327+a, gdbSNP:374380039
3334+g, tdbSNP:201629780
3336+a, gdbSNP:201904856
3349+a, gdbSNP:114774495
3364+g, tdbSNP:199539973
3393+a, gdbSNP:200371555
3408+a, gdbSNP:151286353
3420+a, cdbSNP:146007372
3425+c, tdbSNP:121913331
3437+a, gdbSNP:140493115
3444+a, gdbSNP:28933379
3450+a, gdbSNP:372855304
3459+c, tdbSNP:377278397
3463+c, gdbSNP:149353082
3471+c, tdbSNP:143638171
3500+a, cdbSNP:201550951
3510+a, gdbSNP:138410865
3511+a, tdbSNP:375478525
3521+c, tdbSNP:202168805
3530+a, gdbSNP:371117193
3553..3555+, agadbSNP:386833391
3556+a, gdbSNP:143927847
3559+a, tdbSNP:371597034
3564+a, cdbSNP:201004111
3596+c, tdbSNP:201830995
3597+a, gdbSNP:372481703
3614+a, gdbSNP:369834416
3669+c, tdbSNP:386833392
3693+a, gdbSNP:141444802
3710+a, gdbSNP:201185479
3713+c, tdbSNP:145181563
3735+a, cdbSNP:138933660
3738+c, tdbSNP:377640390
3772+c, tdbSNP:149045486
3775+c, gdbSNP:147268065
3815+a, cdbSNP:79122263
3817+a, gdbSNP:74380081
3824+a, gdbSNP:148223181
3835+a, g, tdbSNP:142728143
3851+a, cdbSNP:77056664
3866+a, gdbSNP:199792739
3871+c, tdbSNP:147411334
3960+c, tdbSNP:371113837
3961+a, gdbSNP:377494451
4001+g, tdbSNP:121913462
4005+a, tdbSNP:1801155
4012..4016+, aaagadbSNP:121913224
4018+c, tdbSNP:201706728
4034+c, gdbSNP:1801166
4048+c, tdbSNP:150595875
4067+c, tdbSNP:398123121
4097+c, tdbSNP:121913327
4157+a, gdbSNP:139618756
4159+a, gdbSNP:149782464
4172+a, gdbSNP:370711075
4173+a, gdbSNP:373607243
4174+a, gdbSNP:113274140
4184+c, tdbSNP:121913328
complement(4193)-t, gdbSNP:377860
4217+c, tdbSNP:121913329
4220+g, tdbSNP:121913326
4268+a, tdbSNP:137854578
4284+c, tdbSNP:267600319
4285+a, gdbSNP:367782881
4297+a, cdbSNP:144655979
4302+a, gdbSNP:372241082
4322+a, gdbSNP:141519952
4334+a, cdbSNP:200166878
4350+a, gdbSNP:368327191
4370+a, c, tdbSNP:74535574
4396+a, gdbSNP:371784771
4411+a, tdbSNP:67622085
4421+a, gdbSNP:146572883
4433+c, tdbSNP:121913332
4444+c, tdbSNP:369121091
4445+a, gdbSNP:111866410
4457+c, tdbSNP:143796828
4460..4462+, actdbSNP:386833393
4469+a, gdbSNP:202204285
4476..4479+, agagdbSNP:387906235
4476+a, gdbSNP:112961968
4477..4478+, gadbSNP:121913334
4478..4479+, agdbSNP:387906234
4505+a, gdbSNP:139387758
4509+c, tdbSNP:375380414
4558..4559+, tdbSNP:398123122
4563+c, tdbSNP:374892194
complement(4572)-g, cdbSNP:2229996
4618+c, tdbSNP:150089434
4656+c, tdbSNP:200803739
4696..4697+, agdbSNP:387906236
4703+c, gdbSNP:73220015
4708+a, gdbSNP:369281524
4771+c, tdbSNP:72541812
4773+c, tdbSNP:201675099
4794+a, gdbSNP:373419559
4795+c, tdbSNP:201764198
4817+g, tdbSNP:138367627
4827+c, gdbSNP:377169217
4850+c, gdbSNP:72541813
4851+a, gdbSNP:374048423
4852+c, tdbSNP:181255489
4870+c, gdbSNP:201287984
4938+c, tdbSNP:185411044
4939+a, gdbSNP:377666490
4978+c, tdbSNP:35634377
4986+c, tdbSNP:370433763
4990+a, gdbSNP:137988845
4998+c, tdbSNP:201797422
5003+c, tdbSNP:373440614
5077+c, tdbSNP:138743276
5094+c, tdbSNP:202228932
5111..5113+, agadbSNP:375262769
5111+a, gdbSNP:370560998
5112+c, gdbSNP:143674116
5119+a, gdbSNP:42427
5153+a, gdbSNP:201142277
5200+c, tdbSNP:373698193
5225+a, gdbSNP:148275069
5232+a, gdbSNP:141298709
5255+c, gdbSNP:201415309
5263+a, gdbSNP:368494571
5298+a, cdbSNP:149882057
5310+a, gdbSNP:199775075
5335+c, gdbSNP:2229997
5340+a, tdbSNP:139552305
5348+g, tdbSNP:371067258
5350+a, gdbSNP:34506289
5359+a, tdbSNP:199600387
5387+a, gdbSNP:199630012
5448+a, gdbSNP:201472075
5459+a, cdbSNP:74853403
5461+a, tdbSNP:76364845
5471+a, gdbSNP:367577259
5477+a, gdbSNP:200794097
5485+c, tdbSNP:376290290
5515+g, tdbSNP:149828124
5557+c, tdbSNP:200742564
5600+g, tdbSNP:75236689
5606+g, tdbSNP:76306073
5613+c, tdbSNP:368080169
5625+c, tdbSNP:371686531
5656+a, cdbSNP:376624613
5658+a, gdbSNP:369831474
5730+c, gdbSNP:34157245
5770+c, gdbSNP:148592182
5775+a, cdbSNP:112610898
5787+a, cdbSNP:72541814
5824+, tdbSNP:142194865
5826+c, gdbSNP:199904481
5830+c, gdbSNP:201988789
5841+a, gdbSNP:147740612
5875+a, gdbSNP:141152252
5890+a, gdbSNP:377040690
5962+g, tdbSNP:369899251
5992+c, gdbSNP:200881543
6003+c, gdbSNP:4987109
6024+a, gdbSNP:180727920
6025+a, cdbSNP:147598747
6027+, adbSNP:397509433
6037+c, tdbSNP:142019870
6067+c, gdbSNP:372852823
6125+a, gdbSNP:143313902
6184+c, gdbSNP:370532497
6202+g, tdbSNP:372418435
6216+a, gdbSNP:375743017
6220+c, tdbSNP:187297940
6258+a, gdbSNP:150140908
6267+a, cdbSNP:370984580
6279+c, tdbSNP:112487226
6334+a, gdbSNP:374625279
6358+c, tdbSNP:368356944
6451+a, tdbSNP:370948574
6458+a, tdbSNP:371097044
6472+a, gdbSNP:374310157
6595+a, cdbSNP:138571760
6607+c, tdbSNP:370781162
6610+a, gdbSNP:200151646
6611+c, tdbSNP:183468041
6620+a, gdbSNP:376096304
6645+a, gdbSNP:146695342
6694+c, tdbSNP:149328018
6719+g, tdbSNP:200682225
6722+a, gdbSNP:186926737
6724+c, tdbSNP:35540155
6743+a, gdbSNP:374464049
6750+c, tdbSNP:367761032
6754+a, gdbSNP:372680843
6755+a, gdbSNP:374597207
6764+g, tdbSNP:367905430
6767+a, gdbSNP:199648202
6809+a, gdbSNP:201375478
6867+c, tdbSNP:376494248
6881..6882+, cdbSNP:375894927
6906+a, gdbSNP:34919187
6936+c, tdbSNP:200468360
6942+c, tdbSNP:200587641
6958+a, tdbSNP:148878262
6985+c, tdbSNP:202012533
7006+a, gdbSNP:2229993
7033+a, gdbSNP:202144406
7070+a, gdbSNP:146048493
7121+c, tdbSNP:200756935
7134+a, c, tdbSNP:75207119
7135+a, cdbSNP:78556145
7137..7138+, cdbSNP:35817266
7190+c, tdbSNP:377308875
7194+g, tdbSNP:140079759
7222+c, gdbSNP:141454910
7278+c, tdbSNP:150882838
7286+c, tdbSNP:2229994
7309+c, tdbSNP:150029348
7480+c, tdbSNP:369906346
7484+a, cdbSNP:372305287
7487+g, tdbSNP:375586273
7500+c, tdbSNP:200399245
7520+a, gdbSNP:369365383
7528+a, tdbSNP:147757080
7556+a, gdbSNP:375674083
7557+c, tdbSNP:369075403
7575+c, tdbSNP:141010008
7580+c, gdbSNP:33941929
7583+c, gdbSNP:372535376
7589+a, gdbSNP:2229995
7598+c, gdbSNP:79630786
7599+a, gdbSNP:147549623
7616+c, tdbSNP:72541815
7649+a, cdbSNP:371149405
7652+g, tdbSNP:4705693
7655+a, gdbSNP:143060722
7679+c, tdbSNP:375080917
7710+a, gdbSNP:151163793
7730+c, tdbSNP:199539353
7731+a, gdbSNP:199558585
7748+a, tdbSNP:370581125
7789+c, tdbSNP:35043160
7802+a, gdbSNP:145444830
7842+g, tdbSNP:199806334
complement(7843)-t, adbSNP:75459601
7851+a, gdbSNP:200406572
7857+a, cdbSNP:375393416
7863+a, gdbSNP:367676584
7871+g, tdbSNP:138137162
7898+c, gdbSNP:201625142
7947+c, gdbSNP:72541816
7950+c, tdbSNP:267600320
7973+a, gdbSNP:199688874
8014+a, gdbSNP:138796072
8028+a, cdbSNP:113486158
8050+g, tdbSNP:1803566
8058+g, tdbSNP:79619757
8088+a, gdbSNP:374886362
8127+c, tdbSNP:182456139
8128+c, gdbSNP:149347068
8145+c, tdbSNP:144746572
8153+a, gdbSNP:140868933
8171+g, tdbSNP:368724873
8215+g, tdbSNP:78176192
8219+c, tdbSNP:76933416
8222+a, cdbSNP:80277939
8284+a, gdbSNP:372365378
8288+a, gdbSNP:376392084
8346+a, gdbSNP:369721828
8351+a, gdbSNP:146115809
8358+a, gdbSNP:371616945
8395+c, gdbSNP:200160084
8463+a, gdbSNP:374853436
8468+a, gdbSNP:369264968
8474+a, gdbSNP:147287751
8484+c, tdbSNP:141024271
8544+c, tdbSNP:200790804
8582+c, gdbSNP:201459013
8649+a, gdbSNP:201206901
8703+a, cdbSNP:1804197
8751+a, c, gdbSNP:76439767
8752+g, tdbSNP:79414727
8754+a, gdbSNP:75440329
8759+c, tdbSNP:6875894
8770+c, gdbSNP:374304258
8865+a, gdbSNP:186777258
8883+a, cdbSNP:191347307
8940+a, gdbSNP:1049291
8948+a, cdbSNP:182711327
8986..8987+, cdbSNP:34867143
8997+c, tdbSNP:62364045
9022..9023+, adbSNP:11432316
9022+a, cdbSNP:79379053
9031..9032+, adbSNP:397817775
9032+a, tdbSNP:200721845
9033+g, tdbSNP:201672843
9034+g, tdbSNP:199854946
9051+c, tdbSNP:12189
9084+a, gdbSNP:74503138
9215+a, cdbSNP:372443882
9251+a, cdbSNP:75495374
9272+g, tdbSNP:114463799
9350+a, gdbSNP:376702694
9370+g, tdbSNP:376855586
9422+a, cdbSNP:75717494
9514..9515+, gdbSNP:34794408
9606+c, tdbSNP:188796337
9657+c, tdbSNP:138328454
9667+c, tdbSNP:17135042
9712+, tdbSNP:35141360
9715+c, tdbSNP:41116
9730+a, gdbSNP:371250804
complement(9732)-g, adbSNP:11558346
9820+a, cdbSNP:6594650
9921+a, gdbSNP:112588804
9937+a, tdbSNP:373883680
10114+c, tdbSNP:138754620
10152+g, tdbSNP:76017392
10342+a, tdbSNP:372708871
10370+a, gdbSNP:397768
10382+, tdbSNP:35060388
10385+a, gdbSNP:149405573
10435+a, gdbSNP:193216000
10535+c, gdbSNP:185342287
10594+c, tdbSNP:1049320
10707+a, cdbSNP:78525333
10728+a, gdbSNP:144766994
Gene SymbolAPC
Gene SynonymBTPS2; DP2; DP2.5; DP3; GS; PPP1R46
Chromosome5
Locus Map5q21-q22
Title Physiological expression of the PI3K-activating mutation Pik3ca(H1047R) combines with Apc loss to promote development of invasive intestinal adenocarcinomas in mice .
Author Hare LM, Phesse TJ, Waring PM, Montgomery KG, Kinross KM, Mills K, Roh V, Heath JK, Ramsay RG, Ernst M and Phillips WA.
Journal Biochem. J. 458 (2), 251-258 (2014)
Title Adenomatous polyposis coli gene involvement in ileal enterochromaffin cell neuroendocrine neoplasms .
Author Bottarelli L, Azzoni C, Pizzi S, D'Adda T, Silini EM, Bordi C and Rindi G.
Journal Hum. Pathol. 44 (12), 2736-2742 (2013)
Title Ultrasensitive detection of unknown colon cancer-initiating mutations using the example of the Adenomatous polyposis coli gene .
Author Gerecke C, Mascher C, Gottschalk U, Kleuser B and Scholtka B.
Journal Cancer Prev Res (Phila) 6 (9), 898-907 (2013)
Title Identification of an alternative 5' untranslated region of the adenomatous polyposis coli gene .
Author Lambertz S and Ballhausen WG.
Journal Hum. Genet. 90 (6), 650-652 (1993)
Title APC-Associated Polyposis Conditions .
Author Jasperson,K.W. and Burt,R.W.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Somatic mutation of the APC gene in gastric cancer: frequent mutations in very well differentiated adenocarcinoma and signet-ring cell carcinoma .
Author Nakatsuru S, Yanagisawa A, Ichii S, Tahara E, Kato Y, Nakamura Y and Horii A.
Journal Hum. Mol. Genet. 1 (8), 559-563 (1992)
Title Disruption of the APC gene by a retrotransposal insertion of L1 sequence in a colon cancer .
Author Miki Y, Nishisho I, Horii A, Miyoshi Y, Utsunomiya J, Kinzler KW, Vogelstein B and Nakamura Y.
Journal Cancer Res. 52 (3), 643-645 (1992)
Title Screening for germ-line mutations in familial adenomatous polyposis patients: 61 new patients and a summary of 150 unrelated patients .
Author Nagase H, Miyoshi Y, Horii A, Aoki T, Petersen GM, Vogelstein B, Maher E, Ogawa M, Maruyama M and Utsunomiya J.
Journal Hum. Mutat. 1 (6), 467-473 (1992)
Title Mutations of chromosome 5q21 genes in FAP and colorectal cancer patients .
Author Nishisho I, Nakamura Y, Miyoshi Y, Miki Y, Ando H, Horii A, Koyama K, Utsunomiya J, Baba S and Hedge P.
Journal Science 253 (5020), 665-669 (1991)
Title Identification of FAP locus genes from chromosome 5q21 .
Author Kinzler KW, Nilbert MC, Su LK, Vogelstein B, Bryan TM, Levy DB, Smith KJ, Preisinger AC, Hedge P and McKechnie D.
Journal Science 253 (5020), 661-665 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.