• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens apolipoprotein A-I (APOA1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000039 Homo sapiens apolipoprotein A-I (APOA1), mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_000039.1, 4557320
Length 897 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens apolipoprotein A-I (APOA1), mRNA.
Product apolipoprotein A-I preproprotein
Comment

Summary: This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq, Jul 2008].

RefSeq NP_000030.1
CDS 39..842
Misc Feature(1)240..839
Misc Feature(2)240..812
Misc Feature(3)366..368
Misc Feature(4)444..446
Exon (1)1..18
Gene:APOA1
Gene Synonym:APOA1
Exon (2)19..81
Gene:APOA1
Gene Synonym:APOA1
Exon (3)82..238
Gene:APOA1
Gene Synonym:APOA1
Exon (4)239..897
Gene:APOA1
Gene Synonym:APOA1
Translation MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ GLLPVLESFKVSFLSALEEYTKKLNTQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(28)-dbSNP:
complement(28)-t, cdbSNP:199729971
complement(47)-g, adbSNP:141383703
complement(117)-dbSNP:
complement(117)-t, gdbSNP:200213347
complement(118)-g, c, adbSNP:121912720
complement(121)-g, cdbSNP:121912721
complement(126)-t, cdbSNP:147246779
complement(139)-t, gdbSNP:28929476
complement(159)-c, adbSNP:201148448
complement(186)-g, cdbSNP:28931574
complement(200)-g, cdbSNP:193922099
complement(204)-t, cdbSNP:121912725
complement(216)-c, adbSNP:199759119
complement(219)-t, cdbSNP:12718465
complement(221)-t, cdbSNP:5071
complement(223)-t, gdbSNP:17407917
complement(258)-dbSNP:
complement(258)-t, cdbSNP:121912726
complement(289)-t, gdbSNP:121912724
complement(299)-c, adbSNP:143796163
complement(322)-t, adbSNP:138407155
complement(326)-c, adbSNP:201320308
complement(339)-t, cdbSNP:143723530
complement(340)-g, adbSNP:17145083
complement(353)-g, adbSNP:148950234
complement(360)-t, cdbSNP:121912723
complement(362)-g, adbSNP:2727787
complement(365)-t, cdbSNP:113733249
complement(377)-c, adbSNP:150243849
complement(379)-t, cdbSNP:28931575
complement(414)-g, cdbSNP:5077
complement(429)-t, adbSNP:121912716
complement(430)-t, adbSNP:4882
complement(516)-g, adbSNP:121912718
complement(530)-t, cdbSNP:141429250
complement(538)-g, cdbSNP:121912719
complement(564)-t, cdbSNP:146623682
complement(577)-t, adbSNP:121912727
complement(589)-g, cdbSNP:5078
complement(593)-g, cdbSNP:143182884
complement(597)-g, adbSNP:1052925
complement(600)-c, adbSNP:140770089
complement(604)-g, cdbSNP:121912722
complement(612)-t, cdbSNP:201218000
complement(627)-t, cdbSNP:28931573
complement(628)-g, cdbSNP:121912728
complement(631)-t, cdbSNP:121912729
complement(633)-g, cdbSNP:121912730
complement(656)-g, adbSNP:5079
complement(683)-t, cdbSNP:199797843
complement(690..691)-g, cdbSNP:1053223
complement(690)-g, cdbSNP:146416257
complement(700)-g, cdbSNP:200394039
complement(702)-g, adbSNP:121912717
complement(708)-t, cdbSNP:14081
complement(770)-g, cdbSNP:5080
complement(819)-t, cdbSNP:143430381
complement(861)-g, cdbSNP:187335584
complement(897)-g, adbSNP:3178226
Gene SymbolAPOA1
Gene SynonymAPOA1
Chromosome11
Locus Map11q23-q24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000039 Homo sapiens apolipoprotein A-I (APOA1), mRNA. On-demand $449.00 14
Title ApoB/ApoA-I ratio is associated with increased risk of bioprosthetic valve degeneration .
Author Mahjoub,H., Mathieu,P., Senechal,M., Larose,E., Dumesnil,J., Despres,J.P. and Pibarot,P.
Journal J. Am. Coll. Cardiol. 61 (7), 752-761 (2013)
Title Lipoprotein remodeling generates lipid-poor apolipoprotein A-I particles in human interstitial fluid .
Author Miller,N.E., Olszewski,W.L., Hattori,H., Miller,I.P., Kujiraoka,T., Oka,T., Iwasaki,T. and Nanjee,M.N.
Journal Am. J. Physiol. Endocrinol. Metab. 304 (3), E321-E328 (2013)
Title Dual role of an N-terminal amyloidogenic mutation in apolipoprotein A-I: destabilization of helix bundle and enhancement of fibril formation .
Author Adachi,E., Nakajima,H., Mizuguchi,C., Dhanasekaran,P., Kawashima,H., Nagao,K., Akaji,K., Lund-Katz,S., Phillips,M.C. and Saito,H.
Journal J. Biol. Chem. 288 (4), 2848-2856 (2013)
Title A high-carbohydrate diet effects on the A allele of hepatic lipase polymorphism on the apoB100/apoAI ratio in young Chinese males .
Author Hu,M., Li,Z. and Fang,D.Z.
Journal Adv Clin Exp Med 21 (6), 751-757 (2012)
Title HDL and apolipoprotein A1 concentrations as markers of cholesterol efflux in middle-aged women: interaction with smoking .
Author Kralova Lesna,I., Poledne,R., Pagacova,L., Stavek,P. and Pitha,J.
Journal Neuro Endocrinol. Lett. 33 (SUPPL 2), 38-42 (2012)
Title Apoprotein (E--A-II) complex of human plasma lipoproteins. I. Characterization of this mixed disulfide and its identification in a high density lipoprotein subfraction .
Author Weisgraber,K.H. and Mahley,R.W.
Journal J. Biol. Chem. 253 (17), 6281-6288 (1978)
Title The amino acid sequence of human APOA-I, an apolipoprotein isolated from high density lipoproteins .
Author Brewer,H.B. Jr., Fairwell,T., LaRue,A., Ronan,R., Houser,A. and Bronzert,T.J.
Journal Biochem. Biophys. Res. Commun. 80 (3), 623-630 (1978)
Title Role of apolipoprotein A-I in the structure of human serum high density lipoproteins. Reconstitution studies .
Author Ritter,M.C. and Scanus,A.M.
Journal J. Biol. Chem. 252 (4), 1208-1216 (1977)
Title The new era in restorative dental materials .
Author Phillips,R.W.
Journal Oper Dent 1 (1), 29-35 (1976)
Title The primary structure of human plasma high density apolipoprotein glutamine I (ApoA-I). II. The amino acid sequence and alignment of cyanogen bromide fragments IV, III, and I .
Author Baker,H.N., Gotto,A.M. Jr. and Jackson,R.L.
Journal J. Biol. Chem. 250 (7), 2725-2738 (1975)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.