• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens apolipoprotein A-I (APOA1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000039 Homo sapiens apolipoprotein A-I (APOA1), mRNA. GenEZ ORF Cloning On-demand $449.00 14

*Business Day

Related Services

RefSeq Version NM_000039.1, 4557320
Length 897 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens apolipoprotein A-I (APOA1), mRNA.
Product apolipoprotein A-I preproprotein
Comment

Summary: This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq, Jul 2008].

RefSeq NP_000030.1
CDS 39..842
Misc Feature(1)240..839
Misc Feature(2)312..812
Misc Feature(3)366..368
Misc Feature(4)444..446
Exon (1)1..18
Gene:APOA1
Gene Synonym:APOA1
Exon (2)19..81
Gene:APOA1
Gene Synonym:APOA1
Exon (3)82..238
Gene:APOA1
Gene Synonym:APOA1
Exon (4)239..897
Gene:APOA1
Gene Synonym:APOA1
Translation MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ GLLPVLESFKVSFLSALEEYTKKLNTQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(28)-dbSNP:
complement(28)-t, cdbSNP:199729971
complement(47)-g, adbSNP:141383703
complement(50)-t, cdbSNP:368534370
complement(93)-dbSNP:
complement(93)-g, adbSNP:371084971
105+c, tdbSNP:387906570
complement(117)-t, gdbSNP:200213347
118+a, c, gdbSNP:121912720
121+c, gdbSNP:121912721
complement(122)-g, adbSNP:369066087
complement(126)-t, cdbSNP:147246779
139+g, tdbSNP:28929476
complement(159)-c, adbSNP:201148448
complement(165)-t, cdbSNP:373545875
186+c, gdbSNP:28931574
200+c, gdbSNP:193922099
204+c, tdbSNP:121912725
complement(216)-c, adbSNP:199759119
complement(219)-t, cdbSNP:12718465
221+c, tdbSNP:5071
223+g, tdbSNP:17407917
258+dbSNP:
258+c, tdbSNP:121912726
complement(275)-g, adbSNP:375453486
289+g, tdbSNP:121912724
complement(299)-c, adbSNP:143796163
complement(322)-t, adbSNP:138407155
complement(326)-c, adbSNP:201320308
complement(334)-g, adbSNP:372520221
complement(339)-t, cdbSNP:143723530
340+a, gdbSNP:17145083
complement(353)-g, adbSNP:148950234
360+c, tdbSNP:121912723
362+a, gdbSNP:2727787
complement(365)-t, cdbSNP:113733249
complement(377)-c, adbSNP:150243849
379+c, tdbSNP:28931575
414+c, gdbSNP:5077
complement(427)-t, cdbSNP:367866651
429+a, tdbSNP:121912716
430+a, tdbSNP:4882
complement(472)-g, adbSNP:373953986
516+a, gdbSNP:121912718
complement(530)-t, cdbSNP:141429250
538+c, gdbSNP:121912719
complement(545)-g, cdbSNP:370526470
556+c, gdbSNP:387906571
complement(564)-t, cdbSNP:146623682
577+a, tdbSNP:121912727
589+c, gdbSNP:5078
complement(593)-g, cdbSNP:143182884
complement(597)-g, adbSNP:1052925
complement(600)-c, adbSNP:140770089
604+c, gdbSNP:121912722
complement(612)-t, cdbSNP:201218000
627+c, tdbSNP:28931573
628+c, gdbSNP:121912728
631+c, tdbSNP:121912729
633+c, gdbSNP:121912730
656+a, gdbSNP:5079
complement(672)-t, cdbSNP:367638050
complement(680)-g, adbSNP:375529707
complement(683)-t, cdbSNP:199797843
complement(689)-g, adbSNP:372930229
690+c, gdbSNP:1053223
complement(700)-g, cdbSNP:200394039
702+a, gdbSNP:121912717
708+c, tdbSNP:14081
complement(762)-t, gdbSNP:368503162
770+c, gdbSNP:5080
complement(819)-t, cdbSNP:143430381
complement(845)-g, adbSNP:374998745
complement(859)-g, adbSNP:370532459
complement(861)-g, cdbSNP:187335584
complement(862)-g, cdbSNP:374923795
complement(869)-t, cdbSNP:370384954
complement(889)-g, adbSNP:377370544
897+a, gdbSNP:3178226
Gene SymbolAPOA1
Gene SynonymAPOA1
Chromosome11
Locus Map11q23-q24
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000039 Homo sapiens apolipoprotein A-I (APOA1), mRNA. On-demand $449.00 14
XM_005271539 PREDICTED: Homo sapiens apolipoprotein A-I (APOA1), transcript variant X1, mRNA. On-demand $449.00 14
XM_005271540 PREDICTED: Homo sapiens apolipoprotein A-I (APOA1), transcript variant X2, mRNA. On-demand $449.00 14
Title Effects of native and myeloperoxidase-modified apolipoprotein a-I on reverse cholesterol transport and atherosclerosis in mice .
Author Hewing B, Parathath S, Barrett T, Chung WK, Astudillo YM, Hamada T, Ramkhelawon B, Tallant TC, Yusufishaq MS, Didonato JA, Huang Y, Buffa J, Berisha SZ, Smith JD, Hazen SL and Fisher EA.
Journal Arterioscler. Thromb. Vasc. Biol. 34 (4), 779-789 (2014)
Title An abundant dysfunctional apolipoprotein A1 in human atheroma .
Author Huang Y, DiDonato JA, Levison BS, Schmitt D, Li L, Wu Y, Buffa J, Kim T, Gerstenecker GS, Gu X, Kadiyala CS, Wang Z, Culley MK, Hazen JE, Didonato AJ, Fu X, Berisha SZ, Peng D, Nguyen TT, Liang S, Chuang CC, Cho L, Plow EF, Fox PL, Gogonea V, Tang WH, Parks JS, Fisher EA, Smith JD and Hazen SL.
Journal Nat. Med. 20 (2), 193-203 (2014)
Title Effect of niacin on high-density lipoprotein apolipoprotein A-I kinetics in statin-treated patients with type 2 diabetes mellitus .
Author Pang J, Chan DC, Hamilton SJ, Tenneti VS, Watts GF and Barrett PH.
Journal Arterioscler. Thromb. Vasc. Biol. 34 (2), 427-432 (2014)
Title The extreme N-terminal region of human apolipoprotein A-I has a strong propensity to form amyloid fibrils .
Author Adachi E, Kosaka A, Tsuji K, Mizuguchi C, Kawashima H, Shigenaga A, Nagao K, Akaji K, Otaka A and Saito H.
Journal FEBS Lett. 588 (3), 389-394 (2014)
Title The conformation of lipid-free human apolipoprotein A-I in solution .
Author Pollard RD, Fulp B, Samuel MP, Sorci-Thomas MG and Thomas MJ.
Journal Biochemistry 52 (52), 9470-9481 (2013)
Title Apoprotein (E--A-II) complex of human plasma lipoproteins. I. Characterization of this mixed disulfide and its identification in a high density lipoprotein subfraction .
Author Weisgraber,K.H. and Mahley,R.W.
Journal J. Biol. Chem. 253 (17), 6281-6288 (1978)
Title The amino acid sequence of human APOA-I, an apolipoprotein isolated from high density lipoproteins .
Author Brewer,H.B. Jr., Fairwell,T., LaRue,A., Ronan,R., Houser,A. and Bronzert,T.J.
Journal Biochem. Biophys. Res. Commun. 80 (3), 623-630 (1978)
Title Role of apolipoprotein A-I in the structure of human serum high density lipoproteins. Reconstitution studies .
Author Ritter,M.C. and Scanus,A.M.
Journal J. Biol. Chem. 252 (4), 1208-1216 (1977)
Title The new era in restorative dental materials .
Author Phillips,R.W.
Journal Oper Dent 1 (1), 29-35 (1976)
Title The primary structure of human plasma high density apolipoprotein glutamine I (ApoA-I). II. The amino acid sequence and alignment of cyanogen bromide fragments IV, III, and I .
Author Baker,H.N., Gotto,A.M. Jr. and Jackson,R.L.
Journal J. Biol. Chem. 250 (7), 2725-2738 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.