• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu47209 Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $1149.00 -1
OHu47209C Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant 1, mRNA. Customized vector In-stock $1149.00 -1

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000053.3, 342187240
Length 4398 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant 1, mRNA.
Product copper-transporting ATPase 2 isoform a
Comment

Summary: This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD). [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript, and encodes the longest isoform (a).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000044.2
CDS 158..4555
Misc Feature(1)338..529
Misc Feature(2)338..529
Misc Feature(3)order(356..364,371..373)
Misc Feature(4)593..784
Misc Feature(5)order(611..619,626..628)
Misc Feature(6)935..1111
Misc Feature(7)order(953..961,968..970)
Misc Feature(8)1244..1432
Misc Feature(9)order(1259..1267,1274..1276)
Misc Feature(10)1631..1819
Misc Feature(11)order(1646..1654,1661..1663)
Misc Feature(12)1853..4222
Misc Feature(13)1856..2047
Misc Feature(14)order(1874..1882,1889..1891)
Misc Feature(15)2117..2182
Misc Feature(16)2249..2308
Misc Feature(17)2330..2392
Misc Feature(18)2450..2512
Misc Feature(19)2462..3205
Misc Feature(20)2915..2983
Misc Feature(21)3074..3139
Misc Feature(22)3692..4009
Misc Feature(23)order(3704..3712,3815..3820)
Misc Feature(24)3704..3721
Misc Feature(25)3815..3817
Misc Feature(26)4124..4177
Misc Feature(27)4211..4270
Exon (1)1..208
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (2)209..1442
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (3)1443..1700
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (4)1701..1864
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (5)1865..2026
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (6)2027..2103
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (7)2104..2278
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (8)2279..2512
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (9)2513..2604
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (10)2605..2732
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (11)2733..2887
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (12)2888..3022
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (13)3023..3217
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (14)3218..3400
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (15)3401..3569
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (16)3570..3713
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (17)3714..3856
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (18)3857..4060
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (19)4061..4178
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (20)4179..4281
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Exon (21)4282..6642
Gene:ATP7B
Gene Synonym:PWD; WC1; WD; WND
Translation MPEQERQITAREGASRKILSKLSLPTRAWEPAMKKSFAFDNVGYEGGLDGLGPSSQVATS TVRILGMTCQSCVKSIEDRISNLKGIISMKVSLEQGSATVKYVPSVVCLQQVCHQIGDMG FEASIAEGKAASWPSRSLPAQEAVVKLRVEGMTCQSCVSSIEGKVRKLQGVVRVKVSLSN QEAVITYQPYLIQPEDLRDHVNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRPLSSAN QNFNNSETLGHQGSHVVTLQLRIDGMHCKSCVLNIEENIGQLLGVQSIQVSLENKTAQVK YDPSCTSPVALQRAIEALPPGNFKVSLPDGAEGSGTDHRSSSSHSPGSPPRNQVQGTCST TLIAIAGMTCASCVHSIEGMISQLEGVQQISVSLAEGTATVLYNPSVISPEELRAAIEDM GFEASVVSESCSTNPLGNHSAGNSMVQTTDGTPTSVQEVAPHTGRLPANHAPDILAKSPQ STRAVAPQKCFLQIKGMTCASCVSNIERNLQKEAGVLSVLVALMAGKAEIKYDPEVIQPL EIAQFIQDLGFEAAVMEDYAGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALA TSKALVKFDPEIIGPRDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKKSFLCSLVF GIPVMALMIYMLIPSNEPHQSMVLDHNIIPGLSILNLIFFILCTFVQLLGGWYFYVQAYK SLRHRSANMDVLIVLATSIAYVYSLVILVVAVAEKAERSPVTFFDTPPMLFVFIALGRWL EHLAKSKTSEALAKLMSLQATEATVVTLGEDNLIIREEQVPMELVQRGDIVKVVPGGKFP VDGKVLEGNTMADESLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIV KLVEEAQMSKAPIQQLADRFSGYFVPFIIIMSTLTLVVWIVIGFIDFGVVQRYFPNPNKH ISQTEVIIRFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGILIKGGKPLEMAHK IKTVMFDKTGTITHGVPRVMRVLLLGDVATLPLRKVLAVVGTAEASSEHPLGVAVTKYCK EELGTETLGYCTDFQAVPGCGIGCKVSNVEGILAHSERPLSAPASHLNEAGSLPAEKDAV PQTFSVLIGNREWLRRNGLTISSDVSDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKQ EAALAVHTLQSMGVDVVLITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGK KVAMVGDGVNDSPALAQADMGVAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRR IRINLVLALIYNLVGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYKKPD LERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSR HSAAADDDGDKWSLLLNGRDEEQYI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(30..31)-dbSNP:
complement(30..31)-, gcggcdbSNP:3832920
complement(30..31)-, gcggcdbSNP:397840787
complement(30)-t, gdbSNP:73184332
complement(38..39)-, cggcgdbSNP:373884822
complement(39..40)-, cggcgdbSNP:148013251
complement(53)-g, adbSNP:71436268
complement(83)-t, gdbSNP:2277448
84+a, cdbSNP:193922101
complement(104)-c, adbSNP:115564351
complement(107)-t, adbSNP:140622583
complement(114)-c, adbSNP:373085452
complement(127)-g, adbSNP:184427928
complement(192)-t, adbSNP:374944498
complement(195)-t, cdbSNP:371758114
complement(219)-dbSNP:
complement(219)-t, cdbSNP:199514391
complement(237)-t, cdbSNP:371345946
complement(255)-g, adbSNP:184868522
complement(269)-t, cdbSNP:377230787
complement(279)-t, cdbSNP:201738967
complement(369)-g, adbSNP:371286388
complement(383)-t, cdbSNP:200642204
complement(393)-t, cdbSNP:375470066
complement(422)-t, cdbSNP:372516400
complement(425)-t, cdbSNP:368013962
complement(504)-g, adbSNP:199773340
complement(520)-g, adbSNP:370199412
complement(523)-c, adbSNP:201778204
complement(553)-g, adbSNP:377081763
568+a, cdbSNP:181154454
590+g, tdbSNP:183365083
complement(599)-g, adbSNP:373762572
complement(601)-t, cdbSNP:370903117
complement(602)-t, cdbSNP:200606656
complement(654)-t, cdbSNP:150490315
complement(707)-t, cdbSNP:199634511
complement(767)-t, cdbSNP:200605351
complement(785)-t, cdbSNP:61733680
complement(821)-t, cdbSNP:200866801
complement(822)-g, adbSNP:373476328
complement(827)-t, adbSNP:200563529
complement(834)-t, cdbSNP:201522558
complement(851)-g, adbSNP:201388026
complement(853)-t, cdbSNP:202171959
complement(897)-t, cdbSNP:376398239
complement(905)-t, cdbSNP:192444554
complement(926)-c, adbSNP:373242731
1002+, tdbSNP:193922111
1022+c, tdbSNP:121907999
complement(1046)-c, adbSNP:369823735
complement(1052)-t, cdbSNP:146791250
1072+a, tdbSNP:398123137
complement(1150)-g, adbSNP:377294197
complement(1154)-t, cdbSNP:200356895
complement(1156)-c, adbSNP:371930715
complement(1193)-g, adbSNP:201200863
complement(1205)-g, adbSNP:375229330
complement(1206)-g, adbSNP:201855906
complement(1207)-t, cdbSNP:372191499
complement(1212)-t, gdbSNP:199922748
complement(1219)-t, gdbSNP:371971772
complement(1270)-t, cdbSNP:187481935
complement(1279)-g, cdbSNP:201254466
complement(1306)-t, cdbSNP:368048282
complement(1313)-t, cdbSNP:201969695
1319+c, tdbSNP:187209079
complement(1330)-t, cdbSNP:200431213
complement(1339)-g, cdbSNP:201874048
complement(1352)-t, cdbSNP:370203816
complement(1355)-t, cdbSNP:199807461
complement(1372)-g, adbSNP:201020290
1373+g, tdbSNP:1801243
complement(1399)-t, gdbSNP:370784013
complement(1432)-t, cdbSNP:377399832
complement(1435)-g, adbSNP:143556945
complement(1448)-dbSNP:
complement(1448)-g, adbSNP:145173864
complement(1471)-g, adbSNP:377234918
complement(1508)-t, cdbSNP:186300062
complement(1519)-t, cdbSNP:150018860
1523+c, gdbSNP:1801244
complement(1532)-c, adbSNP:183044693
complement(1569)-g, adbSNP:376317361
complement(1583)-t, cdbSNP:139289704
complement(1618)-t, cdbSNP:372068316
1649+a, tdbSNP:191631804
complement(1653)-g, cdbSNP:61733681
complement(1712)-dbSNP:
complement(1712)-t, cdbSNP:192957846
complement(1724)-g, adbSNP:368662351
complement(1741)-t, cdbSNP:199703505
complement(1752)-t, cdbSNP:375071383
complement(1764)-g, adbSNP:138427376
complement(1777)-g, adbSNP:145798966
complement(1778)-t, cdbSNP:187046823
complement(1784)-t, cdbSNP:370269554
complement(1806)-t, cdbSNP:377336104
complement(1823)-t, cdbSNP:200212457
complement(1834)-g, adbSNP:142187604
complement(1843)-g, adbSNP:138962570
complement(1844)-t, cdbSNP:199875471
complement(1873)-dbSNP:
complement(1873)-c, adbSNP:371467098
complement(1882)-g, adbSNP:201925666
complement(1885)-t, cdbSNP:116703544
complement(1890)-t, cdbSNP:372378682
complement(1986)-g, adbSNP:368381292
complement(1987)-t, cdbSNP:375689672
complement(1996)-g, adbSNP:370476756
complement(1997)-c, adbSNP:376565432
complement(2003)-g, adbSNP:374172791
complement(2007)-t, cdbSNP:371038011
complement(2019)-g, adbSNP:377670877
complement(2039)-dbSNP:
complement(2039)-g, adbSNP:145516481
complement(2058)-t, cdbSNP:373585491
complement(2061)-t, cdbSNP:369511524
complement(2067)-t, cdbSNP:61733683
complement(2070)-g, adbSNP:373145351
complement(2072)-g, adbSNP:200728096
complement(2076)-t, gdbSNP:369147145
complement(2079)-g, adbSNP:186924074
2081+c, gdbSNP:72552285
complement(2106)-dbSNP:
complement(2106)-t, cdbSNP:375542827
complement(2126)-t, gdbSNP:372436901
complement(2150)-t, cdbSNP:146303208
complement(2151)-c, adbSNP:182653713
complement(2152)-g, adbSNP:72552259
complement(2186)-t, cdbSNP:2277447
complement(2203)-g, cdbSNP:370398602
2228+a, gdbSNP:121908001
2280+dbSNP:
2280+c, tdbSNP:121908000
2285+a, gdbSNP:137853285
complement(2331)-t, cdbSNP:115227204
complement(2332)-t, cdbSNP:61733684
complement(2353)-g, adbSNP:201213995
complement(2402)-c, adbSNP:377141196
2446+c, tdbSNP:186097711
complement(2449)-g, adbSNP:372979339
2450+a, gdbSNP:28942075
2454+c, gdbSNP:121907997
2455..2456+, cdbSNP:137853287
2462+a, gdbSNP:193922103
2467+c, gdbSNP:398123136
2489+c, g, tdbSNP:137853284
2490+g, tdbSNP:28942074
2494+a, gdbSNP:137853282
2552+dbSNP:
2552+g, tdbSNP:78253195
complement(2569)-g, adbSNP:372306234
complement(2632)-dbSNP:
complement(2632)-t, cdbSNP:373528664
complement(2637)-t, cdbSNP:368589213
complement(2642)-t, cdbSNP:181388674
complement(2648)-t, cdbSNP:374592960
2652+a, gdbSNP:1061472
complement(2652)-t, cdbSNP:386514561
2659+c, gdbSNP:188903683
2666+g, tdbSNP:183519418
complement(2701)-g, adbSNP:200996053
complement(2730)-g, adbSNP:373641722
complement(2761)-dbSNP:
complement(2761)-g, adbSNP:368902724
complement(2762)-t, cdbSNP:191312027
2777+c, gdbSNP:376355660
2778+c, tdbSNP:121907994
complement(2824)-g, adbSNP:373539367
complement(2869)-t, cdbSNP:146232015
complement(2887)-t, cdbSNP:80145681
2912+dbSNP:
2912+c, g, tdbSNP:121907993
complement(2922)-c, adbSNP:371254644
2930+a, cdbSNP:77453130
complement(2934)-g, cdbSNP:185149827
complement(2962)-t, cdbSNP:141872590
complement(2963)-c, adbSNP:367855110
2984+a, gdbSNP:28942076
complement(2990)-t, cdbSNP:373757123
complement(2993)-t, cdbSNP:370961504
3012+a, gdbSNP:732774
complement(3012)-g, adbSNP:386609281
complement(3032)-dbSNP:
complement(3032)-t, cdbSNP:368180043
complement(3056)-t, adbSNP:60003608
3063+a, gdbSNP:121907996
complement(3078)-g, adbSNP:201061621
3110+c, tdbSNP:193922104
complement(3112)-g, adbSNP:116587608
complement(3119)-g, cdbSNP:199623434
complement(3129)-g, adbSNP:41292782
3130+a, gdbSNP:1801246
complement(3132)-g, adbSNP:201038679
complement(3135)-g, adbSNP:200290721
complement(3136)-t, cdbSNP:200656411
complement(3151)-g, adbSNP:373102009
complement(3154)-g, cdbSNP:199581971
complement(3163)-g, adbSNP:369620062
complement(3164)-t, cdbSNP:201497300
3166+a, gdbSNP:1801247
complement(3172)-g, adbSNP:74085888
complement(3173)-t, cdbSNP:369241942
3202+a, gdbSNP:1801248
complement(3210)-g, adbSNP:371840514
3211+a, gdbSNP:193922105
complement(3226)-dbSNP:
complement(3226)-g, adbSNP:187343742
complement(3258)-t, cdbSNP:74085882
complement(3262)-g, adbSNP:200324179
complement(3270)-t, cdbSNP:59959366
complement(3317)-t, gdbSNP:377586515
complement(3327)-g, adbSNP:373601229
complement(3334)-g, cdbSNP:199542057
complement(3346)-t, cdbSNP:370527611
complement(3347)-t, cdbSNP:376910645
complement(3348)-t, gdbSNP:374094065
complement(3363)-t, gdbSNP:201738147
complement(3364)-t, gdbSNP:76151636
complement(3364)-t, gdbSNP:386626645
complement(3374)-t, cdbSNP:376112375
complement(3396)-t, cdbSNP:373342365
complement(3418)-dbSNP:
complement(3418)-t, gdbSNP:375820067
complement(3432)-g, adbSNP:368545738
complement(3433)-t, cdbSNP:377020436
complement(3481)-g, adbSNP:372456815
complement(3489)-t, cdbSNP:182659444
complement(3510)-t, cdbSNP:202233544
complement(3523)-t, cdbSNP:59120265
complement(3525)-g, adbSNP:146623472
complement(3526)-t, cdbSNP:61733679
complement(3533)-g, adbSNP:373698024
complement(3553)-g, adbSNP:370947152
3557+, cdbSNP:137853286
3559+, cdbSNP:137853281
complement(3559)-g, adbSNP:145887771
complement(3560)-t, cdbSNP:187200982
complement(3562)-t, cdbSNP:373081328
complement(3570)-dbSNP:
complement(3570)-t, cdbSNP:375721306
complement(3573)-g, cdbSNP:199924281
3576+c, tdbSNP:1801249
complement(3600)-g, adbSNP:60431989
complement(3609)-t, cdbSNP:377297166
complement(3622)-c, adbSNP:201985951
complement(3636)-g, adbSNP:372318135
3683+a, g, tdbSNP:137853279
complement(3740)-dbSNP:
complement(3740)-t, cdbSNP:202218969
complement(3745)-g, adbSNP:11840224
complement(3777)-t, cdbSNP:7334118
complement(3780)-g, adbSNP:370713752
complement(3781)-t, cdbSNP:377267217
complement(3782)-t, gdbSNP:61957448
complement(3809)-g, adbSNP:375931387
3816+c, tdbSNP:193922107
complement(3845)-t, cdbSNP:200911496
3857+dbSNP:
3857+g, tdbSNP:193922108
complement(3872)-c, adbSNP:185912036
complement(3873)-c, adbSNP:374628199
complement(3877)-g, adbSNP:369930314
complement(3895)-t, cdbSNP:376369653
complement(3906)-g, cdbSNP:372042739
complement(3932)-t, cdbSNP:369400229
complement(3943)-g, adbSNP:375007352
3953+a, gdbSNP:121907992
3966+a, gdbSNP:121907990
complement(4020)-g, adbSNP:373748155
complement(4031)-t, cdbSNP:200718740
complement(4042)-g, adbSNP:200597654
complement(4043)-t, cdbSNP:199821556
complement(4046)-t, cdbSNP:148399850
complement(4048)-g, adbSNP:114771537
complement(4071)-dbSNP:
complement(4071)-g, adbSNP:377144951
complement(4108)-g, adbSNP:375443998
complement(4124)-t, cdbSNP:377334296
4130+c, tdbSNP:182060222
4156+g, tdbSNP:186435141
complement(4195)-dbSNP:
complement(4195)-g, adbSNP:200582826
complement(4202)-g, cdbSNP:374924611
complement(4212)-g, adbSNP:113468879
4215+a, c, gdbSNP:193922110
complement(4292)-dbSNP:
complement(4292)-g, adbSNP:181250704
complement(4320)-g, adbSNP:371458882
complement(4332)-c, adbSNP:199821965
complement(4342)-t, cdbSNP:368801566
complement(4370)-t, cdbSNP:189601972
complement(4398)-t, gdbSNP:374693153
complement(4428)-t, cdbSNP:372435824
complement(4430)-t, cdbSNP:368382723
complement(4452)-g, adbSNP:375692175
complement(4458)-g, adbSNP:60986317
complement(4459)-t, cdbSNP:116091486
complement(4463)-t, cdbSNP:148081616
complement(4468)-t, cdbSNP:73202048
complement(4476)-c, adbSNP:201483366
complement(4496)-t, cdbSNP:370285520
complement(4518)-g, adbSNP:377492122
complement(4545)-t, gdbSNP:202131204
complement(4552)-t, gdbSNP:199859839
complement(4570)-t, cdbSNP:386468695
complement(4570)-g, adbSNP:73498144
complement(4578)-c, adbSNP:201108784
complement(4674)-t, cdbSNP:184218772
complement(4703)-g, adbSNP:111901413
complement(4745)-t, gdbSNP:115420019
complement(4836)-t, cdbSNP:144358706
complement(5061)-g, cdbSNP:192584430
complement(5263)-t, cdbSNP:142281044
complement(5389)-t, cdbSNP:189181173
complement(5518)-g, adbSNP:371788814
complement(5564)-t, cdbSNP:79747858
complement(5661)-g, adbSNP:184361144
complement(5673)-t, cdbSNP:74330211
5727+a, gdbSNP:1051332
complement(5727)-t, cdbSNP:386514073
complement(5737)-g, adbSNP:79490882
complement(5777)-c, adbSNP:374845408
complement(5795)-c, adbSNP:145132668
complement(5845)-t, cdbSNP:149956179
complement(5874)-g, adbSNP:368996327
complement(5940)-t, cdbSNP:41292780
complement(5940)-g, adbSNP:386494866
complement(6046)-t, cdbSNP:139053981
complement(6077)-t, cdbSNP:191892694
complement(6132)-g, adbSNP:188364702
complement(6214)-t, cdbSNP:113688195
complement(6224)-g, adbSNP:151138735
complement(6261)-t, cdbSNP:143285115
complement(6263)-t, cdbSNP:17076111
complement(6272)-c, adbSNP:77770386
complement(6299)-g, adbSNP:9535794
complement(6300)-t, cdbSNP:139850360
complement(6302)-t, cdbSNP:192653965
complement(6334)-g, cdbSNP:187959146
6337+c, gdbSNP:928169
complement(6360)-g, adbSNP:182439700
complement(6629)-g, cdbSNP:375117144
Gene SymbolATP7B
Gene SynonymPWD; WC1; WD; WND
Chromosome13
Locus Map13q14.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000053 Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant 1, mRNA. In-stock $1149.00 TBD
NM_001005918 Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant 2, mRNA. On-demand TBD TBD
NM_001243182 Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant 3, mRNA. On-demand $1699.00 25
XM_005266424 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X2, mRNA. On-demand TBD TBD
XM_005266423 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X1, mRNA. On-demand TBD TBD
XM_006719837 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X11, mRNA. On-demand TBD TBD
XM_005266427 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X5, mRNA. On-demand TBD TBD
XM_005266428 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X6, mRNA. On-demand TBD TBD
XM_005266429 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X7, mRNA. On-demand TBD TBD
XM_005266430 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X8, mRNA. On-demand TBD TBD
XM_005266432 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X10, mRNA. On-demand TBD TBD
XM_006719838 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X12, mRNA. On-demand $279.00 12-14
XM_006719839 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X13, mRNA. On-demand $279.00 12-14
XM_005266431 PREDICTED: Homo sapiens ATPase, Cu++ transporting, beta polypeptide (ATP7B), transcript variant X9, mRNA. On-demand TBD TBD
Title Utility of ATP7B in prediction of response to platinum-based chemotherapy in urothelial bladder cancer .
Author Schmid SC, Schuster T, Horn T, Gschwend J, Treiber U and Weirich G.
Journal Anticancer Res. 33 (9), 3731-3737 (2013)
Title Wilson's disease in Southern Brazil: genotype-phenotype correlation and description of two novel mutations in ATP7B gene .
Author Bem RS, Raskin S, Muzzillo DA, Deguti MM, Cancado EL, Araujo TF, Nakhle MC, Barbosa ER, Munhoz RP and Teive HA.
Journal Arq Neuropsiquiatr 71 (8), 503-507 (2013)
Title Novel ATPase Cu(2+) transporting beta polypeptide mutations in Chinese families with Wilson's disease .
Author Gu S, Yang H, Qi Y, Deng X, Zhang L, Guo Y, Huang Q, Li J, Shi X, Song Z and Deng H.
Journal PLoS ONE 8 (7), E66526 (2013)
Title Genetic variability in copper-transporting P-type adenosine triphosphatase (ATP7B) is associated with Alzheimer's disease in a Chinese population .
Author Liu HP, Lin WY, Wang WF, Tsai CH, Wu WC, Chiou MT, Shen CP, Wu BT and Tsai FJ.
Journal J. Biol. Regul. Homeost. Agents 27 (2), 319-327 (2013)
Title Intronic rs2147363 variant in ATP7B transcription factor-binding site associated with Alzheimer's disease .
Author Bucossi S, Polimanti R, Ventriglia M, Mariani S, Siotto M, Ursini F, Trotta L, Scrascia F, Callea A, Vernieri F and Squitti R.
Journal J. Alzheimers Dis. 37 (2), 453-459 (2013)
Title Characterization of the Wilson disease gene encoding a P-type copper transporting ATPase: genomic organization, alternative splicing, and structure/function predictions .
Author Petrukhin K, Lutsenko S, Chernov I, Ross BM, Kaplan JH and Gilliam TC.
Journal Hum. Mol. Genet. 3 (9), 1647-1656 (1994)
Title Mapping, cloning and genetic characterization of the region containing the Wilson disease gene .
Author Petrukhin K, Fischer SG, Pirastu M, Tanzi RE, Chernov I, Devoto M, Brzustowicz LM, Cayanis E, Vitale E and Russo JJ.
Journal Nat. Genet. 5 (4), 338-343 (1993)
Title The Wilson disease gene is a putative copper transporting P-type ATPase similar to the Menkes gene .
Author Bull PC, Thomas GR, Rommens JM, Forbes JR and Cox DW.
Journal Nat. Genet. 5 (4), 327-337 (1993)
Title Isolation and characterization of a human liver cDNA as a candidate gene for Wilson disease .
Author Yamaguchi Y, Heiny ME and Gitlin JD.
Journal Biochem. Biophys. Res. Commun. 197 (1), 271-277 (1993)
Title Wilson Disease .
Author Weiss,K.H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.