• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens butyrylcholinesterase (BCHE), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19300 Homo sapiens butyrylcholinesterase (BCHE), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu19300C Homo sapiens butyrylcholinesterase (BCHE), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000055.2, 148277049
Length 1809 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens butyrylcholinesterase (BCHE), mRNA.
Product cholinesterase precursor
Comment

Summary: Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage. [provided by RefSeq, Jul 2008].

RefSeq NP_000046.1
CDS 161..1969
Misc Feature(1)35..37
Misc Feature(2)35..37
Misc Feature(3)257..1780
Misc Feature(4)293..295
Misc Feature(5)413..415
Misc Feature(6)<533..>910
Misc Feature(7)560..562
Misc Feature(8)order(587..595,833..841,848..850,1301..1303,1313..1318,
Misc Feature(9)590..595
Misc Feature(10)order(836..838,1217..1219,1556..1558)
Misc Feature(11)836..838
Misc Feature(12)965..967
Misc Feature(13)1010..1012
Misc Feature(14)1265..1267
Misc Feature(15)1607..1609
Misc Feature(16)1685..1687
Misc Feature(17)1700..1702
Misc Feature(18)1853..1966
Exon (1)1..152
Gene:BCHE
Gene Synonym:CHE1; CHE2; E1
Exon (2)153..1677
Gene:BCHE
Gene Synonym:CHE1; CHE2; E1
Exon (3)1678..1844
Gene:BCHE
Gene Synonym:CHE1; CHE2; E1
Exon (4)1845..2447
Gene:BCHE
Gene Synonym:CHE1; CHE2; E1
Translation MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIP YAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDC LYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG FLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPG SHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVY GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLER RDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMT KLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV GL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
129+a, gdbSNP:1126680
complement(129)-t, cdbSNP:386517975
complement(169)-t, gdbSNP:149985624
complement(176)-t, adbSNP:55950599
complement(181)-t, gdbSNP:374939607
complement(197)-t, gdbSNP:372942772
complement(227)-t, cdbSNP:114063013
complement(279)-t, cdbSNP:116047990
complement(289)-g, cdbSNP:201226143
complement(315)-g, adbSNP:56309853
complement(316)-t, cdbSNP:150673481
complement(319)-t, cdbSNP:368402967
complement(321)-g, adbSNP:377250579
complement(324)-t, g, cdbSNP:114355070
complement(342)-t, cdbSNP:116097205
complement(353)-g, adbSNP:148170012
complement(371)-t, adbSNP:367844208
complement(406)-g, adbSNP:374649054
complement(453)-t, cdbSNP:386545549
complement(458)-t, adbSNP:370612464
complement(474)-t, cdbSNP:200035175
complement(487)-t, cdbSNP:149045543
complement(506)-g, adbSNP:374198965
complement(515)-c, adbSNP:137883811
542+c, tdbSNP:3732880
complement(542)-g, adbSNP:386584927
complement(588)-t, cdbSNP:201820739
complement(594..595)-, tdbSNP:55703238
complement(595)-t, c, adbSNP:71534242
595+ag, tdbSNP:398124632
complement(607)-t, cdbSNP:114203545
complement(625)-g, adbSNP:200478369
627+a, gdbSNP:121918558
complement(648)-t, cdbSNP:141243848
complement(681)-t, cdbSNP:147790353
complement(692)-t, cdbSNP:149719695
complement(695)-g, adbSNP:140807357
complement(721)-t, adbSNP:151020233
complement(730)-g, adbSNP:115463466
complement(733)-t, cdbSNP:139541965
complement(758)-g, adbSNP:376351866
complement(795)-g, adbSNP:114706984
complement(803)-t, cdbSNP:373564630
complement(813)-t, cdbSNP:143560894
complement(836)-t, cdbSNP:370077923
complement(850)-g, adbSNP:114127364
complement(877)-g, adbSNP:187613357
complement(917)-c, adbSNP:140080572
complement(1008)-t, cdbSNP:375775245
complement(1009)-g, cdbSNP:16849700
complement(1044)-t, cdbSNP:115624085
complement(1054)-t, cdbSNP:138271111
complement(1065)-g, adbSNP:372593716
complement(1094)-t, adbSNP:114991020
complement(1101)-c, adbSNP:142586213
complement(1119)-g, adbSNP:116607681
complement(1120)-t, cdbSNP:368885671
complement(1152)-t, gdbSNP:150912772
1164+c, tdbSNP:104893684
complement(1231)-g, adbSNP:376091945
1232+a, tdbSNP:121918557
complement(1237)-g, adbSNP:143300460
complement(1238)-c, adbSNP:201120931
complement(1255)-g, cdbSNP:139312740
complement(1297)-t, cdbSNP:372839550
complement(1302)-c, adbSNP:373114728
complement(1310)-t, cdbSNP:146936556
complement(1337)-g, cdbSNP:115129687
complement(1357)-, adbSNP:35979453
complement(1402)-g, adbSNP:142671799
complement(1419)-g, adbSNP:369207253
complement(1443)-t, cdbSNP:149097236
complement(1484)-t, adbSNP:369840366
complement(1487)-t, gdbSNP:144987429
complement(1490)-t, cdbSNP:201490686
complement(1511)-g, cdbSNP:373022811
complement(1513)-g, adbSNP:267599673
complement(1531)-t, cdbSNP:369712135
complement(1573)-t, cdbSNP:370506433
complement(1579)-g, cdbSNP:377230118
complement(1585)-g, adbSNP:372860529
complement(1590)-g, adbSNP:200151790
complement(1598)-t, cdbSNP:150384913
complement(1621)-g, adbSNP:74458984
complement(1622)-t, cdbSNP:200998515
complement(1652)-g, adbSNP:115017300
complement(1692)-dbSNP:
complement(1692)-g, cdbSNP:200768861
complement(1704)-g, cdbSNP:371869257
complement(1710)-t, cdbSNP:367912630
1734+a, tdbSNP:121918556
complement(1749)-t, gdbSNP:371901966
complement(1773)-g, adbSNP:77586249
complement(1779)-g, adbSNP:200817146
complement(1787)-g, adbSNP:199660374
complement(1788)-t, cdbSNP:374499560
complement(1815)-g, adbSNP:116333990
complement(1822)-g, adbSNP:116021719
complement(1824)-t, gdbSNP:199551421
complement(1851)-dbSNP:
complement(1851)-g, adbSNP:114166903
1859+a, gdbSNP:1803274
complement(1875)-t, cdbSNP:151075873
complement(1929)-t, cdbSNP:199590217
complement(1941)-c, adbSNP:142859898
complement(1954)-g, adbSNP:148569288
complement(1958)-t, cdbSNP:373551373
complement(1982)-g, adbSNP:56084310
complement(2005..2022)-, atttttgccttgatctaadbSNP:201751925
complement(2025)-g, cdbSNP:191995340
2108+a, tdbSNP:145327297
2149+c, tdbSNP:139885577
2158+a, gdbSNP:3495
complement(2159)-g, adbSNP:55765003
complement(2170)-t, cdbSNP:55781241
2175+a, cdbSNP:1042406
complement(2218)-t, adbSNP:150581482
complement(2250)-t, gdbSNP:55753636
complement(2254)-g, adbSNP:55729116
2257..2258+, tdbSNP:397762799
complement(2257)-c, adbSNP:371032418
complement(2262..2263)-, tdbSNP:3836432
complement(2263)-g, adbSNP:199567692
complement(2284)-g, adbSNP:369786680
complement(2318)-t, cdbSNP:55849903
complement(2417)-g, adbSNP:148490591
complement(2424)-g, adbSNP:187886111
complement(2436)-g, cdbSNP:144542474
Gene SymbolBCHE
Gene SynonymCHE1; CHE2; E1
Chromosome3
Locus Map3q26.1-q26.2
Title Kinetic characterization of high-activity mutants of human butyrylcholinesterase for the cocaine metabolite norcocaine .
Author Zhan M, Hou S, Zhan CG and Zheng F.
Journal Biochem. J. 457 (1), 197-206 (2014)
Title 1914G variant of BCHE gene associated with enzyme activity, obesity and triglyceride levels .
Author Lima JK, Leite N, Turek LV, Souza RL, da Silva Timossi L, Osiecki AC, Osiecki R and Furtado-Alle L.
Journal Gene 532 (1), 24-26 (2013)
Title Effects of viscosity and osmotic stress on the reaction of human butyrylcholinesterase with cresyl saligenin phosphate, a toxicant related to aerotoxic syndrome: kinetic and molecular dynamics studies .
Author Masson P, Lushchekina S, Schopfer LM and Lockridge O.
Journal Biochem. J. 454 (3), 387-399 (2013)
Title 2-Arachidonoylglycerol is a substrate for butyrylcholinesterase: A potential mechanism for extracellular endocannabinoid regulation .
Author Barricklow J and Blatnik M.
Journal Arch. Biochem. Biophys. 536 (1), 1-5 (2013)
Title Aspirin hydrolysis in plasma is a variable function of butyrylcholinesterase and platelet-activating factor acetylhydrolase 1b2 (PAFAH1b2) .
Author Zhou G, Marathe GK, Hartiala J, Hazen SL, Allayee H, Tang WH and McIntyre TM.
Journal J. Biol. Chem. 288 (17), 11940-11948 (2013)
Title Refinement of the localization of human butyrylcholinesterase to chromosome 3q26.1-q26.2 using a PCR-derived probe .
Author Gaughan G, Park H, Priddle J, Craig I and Craig S.
Journal Genomics 11 (2), 455-458 (1991)
Title The cloned butyrylcholinesterase (BCHE) gene maps to a single chromosome site, 3q26 .
Author Allderdice PW, Gardner HA, Galutira D, Lockridge O, LaDu BN and McAlpine PJ.
Journal Genomics 11 (2), 452-454 (1991)
Title Evidence for a single butyrylcholinesterase gene in individuals carrying the C5 plasma cholinesterase variant (CHE2) .
Author Masson P, Chatonnet A and Lockridge O.
Journal FEBS Lett. 262 (1), 115-118 (1990)
Title Structure of the gene for human butyrylcholinesterase. Evidence for a single copy .
Author Arpagaus M, Kott M, Vatsis KP, Bartels CF, La Du BN and Lockridge O.
Journal Biochemistry 29 (1), 124-131 (1990)
Title Complete amino acid sequence of human serum cholinesterase .
Author Lockridge,O., Bartels,C.F., Vaughan,T.A., Wong,C.K., Norton,S.E. and Johnson,L.L.
Journal J. Biol. Chem. 262 (2), 549-557 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.