• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens butyrylcholinesterase (BCHE), mRNA.


RefSeq Accession Definition Services Price Order
NM_000055 Homo sapiens butyrylcholinesterase (BCHE), mRNA. ORF Sequence $524.61
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000055.2, 148277049
Length 2461 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens butyrylcholinesterase (BCHE), mRNA.
Product cholinesterase precursor
Comment

Summary: Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage. [provided by RefSeq, Jul 2008].

RefSeq NP_000046.1
CDS 161..1969
Misc Feature(1)35..37
Misc Feature(2)35..37
Misc Feature(3)257..1810
Misc Feature(4)257..1780
Misc Feature(5)293..295
Misc Feature(6)413..415
Misc Feature(7)560..562
Misc Feature(8)order(587..595,833..841,848..850,1301..1303,1313..1318,
Misc Feature(9)590..595
Misc Feature(10)order(836..838,1217..1219,1556..1558)
Misc Feature(11)836..838
Misc Feature(12)965..967
Misc Feature(13)1010..1012
Misc Feature(14)1265..1267
Misc Feature(15)1607..1609
Misc Feature(16)1685..1687
Misc Feature(17)1700..1702
Misc Feature(18)1853..1966
Exon (1)1..152
Gene:BCHE
Gene Synonym:CHE1; E1
Exon (2)153..1677
Gene:BCHE
Gene Synonym:CHE1; E1
Exon (3)1678..1844
Gene:BCHE
Gene Synonym:CHE1; E1
Exon (4)1845..2447
Gene:BCHE
Gene Synonym:CHE1; E1
Translation MHSKVTIICIRFLFWFLLLCMLIGKSHTEDDIIIATKNGKVRGMNLTVFGGTVTAFLGIP YAQPPLGRLRFKKPQSLTKWSDIWNATKYANSCCQNIDQSFPGFHGSEMWNPNTDLSEDC LYLNVWIPAPKPKNATVLIWIYGGGFQTGTSSLHVYDGKFLARVERVIVVSMNYRVGALG FLALPGNPEAPGNMGLFDQQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPG SHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEI LLNEAFVVPYGTPLSVNFGPTVDGDFLTDMPDILLELGQFKKTQILVGVNKDEGTAFLVY GAPGFSKDNNSIITRKEFQEGLKIFFPGVSEFGKESILFHYTDWVDDQRPENYREALGDV VGDYNFICPALEFTKKFSEWGNNAFFYYFEHRSSKLPWPEWMGVMHGYEIEFVFGLPLER RDNYTKAEEILSRSIVKRWANFAKYGNPNETQNNSTSWPVFKSTEQKYLTLNTESTRIMT KLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCV GL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(129)-g, adbSNP:1126680
complement(169)-t, gdbSNP:149985624
complement(176)-t, adbSNP:55950599
complement(227)-t, cdbSNP:114063013
complement(279)-t, cdbSNP:116047990
complement(289)-g, cdbSNP:201226143
complement(315)-g, adbSNP:56309853
complement(316)-t, cdbSNP:150673481
complement(324)-t, g, cdbSNP:114355070
complement(342)-t, cdbSNP:116097205
complement(353)-g, adbSNP:148170012
complement(453)-g, adbSNP:1799807
complement(474)-t, cdbSNP:200035175
complement(487)-t, cdbSNP:149045543
complement(515)-c, adbSNP:137883811
complement(542)-t, cdbSNP:3732880
complement(588)-t, cdbSNP:201820739
complement(594..595)-, tdbSNP:55703238
complement(595)-t, c, adbSNP:71534242
complement(607)-t, cdbSNP:114203545
complement(625)-g, adbSNP:200478369
complement(627)-g, adbSNP:121918558
complement(648)-t, cdbSNP:141243848
complement(681)-t, cdbSNP:147790353
complement(692)-t, cdbSNP:149719695
complement(695)-g, adbSNP:140807357
complement(721)-t, adbSNP:151020233
complement(730)-g, adbSNP:115463466
complement(733)-t, cdbSNP:139541965
complement(795)-g, adbSNP:114706984
complement(813)-t, cdbSNP:143560894
complement(850)-g, adbSNP:114127364
complement(877)-g, adbSNP:187613357
complement(917)-c, adbSNP:140080572
complement(972)-t, cdbSNP:28933389
complement(1009)-g, cdbSNP:16849700
complement(1044)-t, cdbSNP:115624085
complement(1054)-t, cdbSNP:138271111
complement(1094)-t, adbSNP:114991020
complement(1101)-c, adbSNP:142586213
complement(1119)-g, adbSNP:116607681
complement(1152)-t, gdbSNP:150912772
complement(1164)-t, cdbSNP:104893684
complement(1232)-t, adbSNP:121918557
complement(1237)-g, adbSNP:143300460
complement(1238)-c, adbSNP:201120931
complement(1255)-g, cdbSNP:139312740
complement(1310)-t, cdbSNP:146936556
complement(1337)-g, cdbSNP:115129687
complement(1357)-, adbSNP:35979453
complement(1402)-g, adbSNP:142671799
complement(1413)-t, gdbSNP:28933390
complement(1416)-t, adbSNP:143074004
complement(1443)-t, cdbSNP:149097236
complement(1487)-t, gdbSNP:144987429
complement(1490)-t, cdbSNP:201490686
complement(1590)-g, adbSNP:200151790
complement(1598)-t, cdbSNP:150384913
complement(1621)-g, adbSNP:74458984
complement(1622)-t, cdbSNP:200998515
complement(1652)-g, adbSNP:115017300
complement(1692)-dbSNP:
complement(1692)-g, cdbSNP:200768861
complement(1734)-t, adbSNP:121918556
complement(1773)-g, adbSNP:77586249
complement(1779)-g, adbSNP:200817146
complement(1787)-g, adbSNP:199660374
complement(1815)-g, adbSNP:116333990
complement(1822)-g, adbSNP:116021719
complement(1824)-t, gdbSNP:199551421
complement(1851)-dbSNP:
complement(1851)-g, adbSNP:114166903
complement(1859)-g, adbSNP:1803274
complement(1875)-t, cdbSNP:151075873
complement(1929)-t, cdbSNP:199590217
complement(1941)-c, adbSNP:142859898
complement(1954)-g, adbSNP:148569288
complement(1982)-g, adbSNP:56084310
complement(2005..2022)-, atttttgccttgatctaadbSNP:201751925
complement(2025)-g, cdbSNP:191995340
complement(2108)-t, adbSNP:145327297
complement(2149)-t, cdbSNP:139885577
complement(2158)-g, adbSNP:3495
complement(2159)-g, adbSNP:55765003
complement(2170)-t, cdbSNP:55781241
complement(2175)-c, adbSNP:1042406
complement(2218)-t, adbSNP:150581482
complement(2250)-t, gdbSNP:55753636
complement(2254)-g, adbSNP:55729116
complement(2261..2262)-, tdbSNP:17846900
complement(2262..2263)-, tdbSNP:3836432
complement(2263)-g, adbSNP:199567692
complement(2318)-t, cdbSNP:55849903
complement(2417)-g, adbSNP:148490591
complement(2424)-g, adbSNP:187886111
complement(2436)-g, cdbSNP:144542474
Gene SymbolBCHE
Gene SynonymCHE1; E1
Chromosome3
Locus Map3q26.1-q26.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000055 Homo sapiens butyrylcholinesterase (BCHE), mRNA. Full Length $713.69
ORF Sequence $524.61
Title Why does the G117H mutation considerably improve the activity of human butyrylcholinesterase against sarin? Insights from quantum mechanical/molecular mechanical free energy calculations .
Author Yao,Y., Liu,J. and Zhan,C.G.
Journal Biochemistry 51 (44), 8980-8992 (2012)
Title Probing the peripheral site of human butyrylcholinesterase .
Author Macdonald,I.R., Martin,E., Rosenberry,T.L. and Darvesh,S.
Journal Biochemistry 51 (36), 7046-7053 (2012)
Title Laser captured hepatocytes show association of butyrylcholinesterase gene loss and fibrosis progression in hepatitis C-infected drug users .
Author Munshaw,S., Hwang,H.S., Torbenson,M., Quinn,J., Hansen,K.D., Astemborski,J., Mehta,S.H., Ray,S.C., Thomas,D.L. and Balagopal,A.
Journal Hepatology 56 (2), 544-554 (2012)
Title Cholinesterase activities and biochemical determinations in patients with prostate cancer: influence of Gleason score, treatment and bone metastasis .
Author Battisti,V., Bagatini,M.D., Maders,L.D., Chiesa,J., Santos,K.F., Goncalves,J.F., Abdalla,F.H., Battisti,I.E., Schetinger,M.R. and Morsch,V.M.
Journal Biomed. Pharmacother. 66 (4), 249-255 (2012)
Title [Pseudocholinesterase activity in type 1 bipolar patients] .
Author Ezzaher,A., Haj Mouhamed,D., Mechri,A., Neffati,F., Douki,W., Gaha,L. and Najjar,M.F.
Journal Ann. Biol. Clin. (Paris) 70 (1), 25-31 (2012)
Title Refinement of the localization of human butyrylcholinesterase to chromosome 3q26.1-q26.2 using a PCR-derived probe .
Author Gaughan,G., Park,H., Priddle,J., Craig,I. and Craig,S.
Journal Genomics 11 (2), 455-458 (1991)
Title The cloned butyrylcholinesterase (BCHE) gene maps to a single chromosome site, 3q26 .
Author Allderdice,P.W., Gardner,H.A., Galutira,D., Lockridge,O., LaDu,B.N. and McAlpine,P.J.
Journal Genomics 11 (2), 452-454 (1991)
Title Identification of a frameshift mutation responsible for the silent phenotype of human serum cholinesterase, Gly 117 (GGT----GGAG) .
Author Nogueira,C.P., McGuire,M.C., Graeser,C., Bartels,C.F., Arpagaus,M., Van der Spek,A.F., Lightstone,H., Lockridge,O. and La Du,B.N.
Journal Am. J. Hum. Genet. 46 (5), 934-942 (1990)
Title Structure of the gene for human butyrylcholinesterase. Evidence for a single copy .
Author Arpagaus,M., Kott,M., Vatsis,K.P., Bartels,C.F., La Du,B.N. and Lockridge,O.
Journal Biochemistry 29 (1), 124-131 (1990)
Title Complete amino acid sequence of human serum cholinesterase .
Author Lockridge,O., Bartels,C.F., Vaughan,T.A., Wong,C.K., Norton,S.E. and Johnson,L.L.
Journal J. Biol. Chem. 262 (2), 549-557 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878