• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu27234 Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu27234C Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000076.2, 169790897
Length 951 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA.
Product cyclin-dependent kinase inhibitor 1C isoform a
Comment

Summary: This gene is imprinted, with preferential expression of the maternal allele. The encoded protein is a tight-binding, strong inhibitor of several G1 cyclin/Cdk complexes and a negative regulator of cell proliferation. Mutations in this gene are implicated in sporadic cancers and Beckwith-Wiedemann syndorome, suggesting that this gene is a tumor suppressor candidate. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2010].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longer isoform (a).

RefSeq NP_000067.1
CDS 277..1227
Misc Feature(1)34..36
Misc Feature(2)367..525
Misc Feature(3)367..525
Misc Feature(4)742..915
Misc Feature(5)1078..1080
Misc Feature(6)1108..1119
Exon (1)1..1096
Gene:CDKN1C
Gene Synonym:BWCR; BWS; KIP2; p57; p57Kip2; WBS
Exon (2)1097..1232
Gene:CDKN1C
Gene Synonym:BWCR; BWS; KIP2; p57; p57Kip2; WBS
Exon (3)1233..1930
Gene:CDKN1C
Gene Synonym:BWCR; BWS; KIP2; p57; p57Kip2; WBS
Translation MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNR WDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLE PAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAP APAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLAD QLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA APGVGSVEQTPRKRLR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(11)-t, cdbSNP:147317732
complement(129)-g, adbSNP:1054463
complement(192)-t, cdbSNP:143992355
complement(193)-t, cdbSNP:188494894
complement(287)-g, adbSNP:201368350
complement(293)-g, adbSNP:201715947
complement(295)-g, adbSNP:374634184
complement(348)-t, cdbSNP:3852522
complement(408)-g, adbSNP:149717696
415+c, tdbSNP:137852766
complement(522)-t, cdbSNP:141005361
complement(556)-t, adbSNP:400377
586..587+ct, gdbSNP:387906399
complement(728)-g, adbSNP:385101
complement(752)-g, adbSNP:372633
complement(795)-t, gdbSNP:399771
complement(815)-g, adbSNP:113374868
complement(831)-g, adbSNP:191294997
complement(837)-g, adbSNP:384713
complement(843)-g, adbSNP:112196492
869+c, gdbSNP:2583439
887+c, gdbSNP:2583440
complement(893)-g, cdbSNP:1182342
complement(926)-t, adbSNP:3741342
complement(984)-t, cdbSNP:3741341
1016+a, cdbSNP:104894200
1096+a, gdbSNP:387907225
1102+dbSNP:
1102+g, tdbSNP:387907223
1103+c, tdbSNP:387907224
1108+a, gdbSNP:387907226
1112+c, g, tdbSNP:318240750
1121+a, c, gdbSNP:267606716
complement(1137)-t, cdbSNP:373252940
complement(1140)-t, cdbSNP:370564696
1179+a, cdbSNP:1802775
complement(1185)-g, adbSNP:377216794
1341+dbSNP:
1341+c, gdbSNP:11550171
complement(1378)-t, cdbSNP:13563
complement(1430)-t, cdbSNP:370352968
complement(1505)-t, cdbSNP:1052593
complement(1678)-t, gdbSNP:12801085
complement(1679)-t, gdbSNP:12793537
1751+c, gdbSNP:181826383
Gene SymbolCDKN1C
Gene SynonymBWCR; BWS; KIP2; p57; p57Kip2; WBS
Chromosome11
Locus Map11p15.5
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000076 Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA. On-demand TBD TBD
NM_000076 Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA. On-demand TBD TBD
NM_000076 Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA. On-demand TBD TBD
NM_000076 Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA. On-demand TBD TBD
NM_000076 Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA. On-demand TBD TBD
NM_000076 Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA. On-demand TBD TBD
NM_000076 Homo sapiens cyclin-dependent kinase inhibitor 1C (p57, Kip2) (CDKN1C), transcript variant 1, mRNA. On-demand TBD TBD
Title Utility of fluorescence in situ hybridization for ploidy and p57 immunostaining in discriminating hydatidiform moles .
Author Chen KH, Hsu SC, Chen HY, Ng KF and Chen TC.
Journal Biochem. Biophys. Res. Commun. 446 (2), 555-560 (2014)
Title Loss of p57 expression and RhoA overexpression are associated with poor survival of patients with hepatocellular carcinoma .
Author Hu T, Guo H, Wang W, Yu S, Han L, Jiang L, Ma J, Yang C, Guo Q and Nan K.
Journal Oncol. Rep. 30 (4), 1707-1714 (2013)
Title Increased protein stability of CDKN1C causes a gain-of-function phenotype in patients with IMAGe syndrome .
Author Hamajima N, Johmura Y, Suzuki S, Nakanishi M and Saitoh S.
Journal PLoS ONE 8 (9), E75137 (2013)
Title Oligodendroglial lineage cells express nuclear p57kip2 in multiple sclerosis lesions .
Author Pfeifenbring S, Metz I, Kremer D, Kury P, Hartung HP and Bruck W.
Journal Glia 61 (8), 1250-1260 (2013)
Title Imprinting of the gene encoding a human cyclin-dependent kinase inhibitor, p57KIP2, on chromosome 11p15 .
Author Matsuoka S, Thompson JS, Edwards MC, Bartletta JM, Grundy P, Kalikin LM, Harper JW, Elledge SJ and Feinberg AP.
Journal Proc. Natl. Acad. Sci. U.S.A. 93 (7), 3026-3030 (1996)
Title p57KIP2, a structurally distinct member of the p21CIP1 Cdk inhibitor family, is a candidate tumor suppressor gene .
Author Matsuoka S, Edwards MC, Bai C, Parker S, Zhang P, Baldini A, Harper
Journal Genes Dev. 9 (6), 650-662 (1995)
Title Cloning of p57KIP2, a cyclin-dependent kinase inhibitor with unique domain structure and tissue distribution .
Author Lee MH, Reynisdottir I and Massague J.
Journal Genes Dev. 9 (6), 639-649 (1995)
Title IMAGe Syndrome .
Author Bennett,J., Schrier Vergano,S. and Deardorff,M.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Beckwith-Wiedemann Syndrome .
Author Shuman,C., Beckwith,J.B., Smith,A.C. and Weksberg,R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Genes associated with tumor suppression and growth control in the human nervous system .
Author Seizinger BR.
Journal Cancer Metastasis Rev. 10 (4), 281-287 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.