• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens collagen, type I, alpha 1 (COL1A1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000088 Homo sapiens collagen, type I, alpha 1 (COL1A1), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_000088.3, 110349771
Length 5927 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens collagen, type I, alpha 1 (COL1A1), mRNA.
Product collagen alpha-1(I) chain preproprotein
Comment

Summary: This gene encodes the pro-alpha1 chains of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIA, Ehlers-Danlos syndrome Classical type, Caffey Disease and idiopathic osteoporosis. Reciprocal translocations between chromosomes 17 and 22, where this gene and the gene for platelet-derived growth factor beta are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans, resulting from unregulated expression of the growth factor. Two transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene. [provided by R. Dalgleish, Feb 2008].

RefSeq NP_000079.2
CDS 127..4521
Misc Feature(1)115..117
Misc Feature(2)244..411
Misc Feature(3)397..399
Misc Feature(4)478..480
Misc Feature(5)607..612
Misc Feature(6)610..660
Misc Feature(7)610..612
Misc Feature(8)634..636
Misc Feature(9)661..3702
Misc Feature(10)919..921
Misc Feature(11)2302..2424
Misc Feature(12)2359..2367
Misc Feature(13)2983..2988
Misc Feature(14)3001..3234
Misc Feature(15)3403..3411
Misc Feature(16)3703..3780
Misc Feature(17)3778..3783
Misc Feature(18)3859..4515
Exon (1)1..229
Gene:COL1A1
Gene Synonym:OI4
Exon (2)230..424
Gene:COL1A1
Gene Synonym:OI4
Exon (3)425..459
Gene:COL1A1
Gene Synonym:OI4
Exon (4)460..495
Gene:COL1A1
Gene Synonym:OI4
Exon (5)496..597
Gene:COL1A1
Gene Synonym:OI4
Exon (6)598..669
Gene:COL1A1
Gene Synonym:OI4
Exon (7)670..714
Gene:COL1A1
Gene Synonym:OI4
Exon (8)715..768
Gene:COL1A1
Gene Synonym:OI4
Exon (9)769..822
Gene:COL1A1
Gene Synonym:OI4
Exon (10)823..876
Gene:COL1A1
Gene Synonym:OI4
Exon (11)877..930
Gene:COL1A1
Gene Synonym:OI4
Exon (12)931..984
Gene:COL1A1
Gene Synonym:OI4
Exon (13)985..1029
Gene:COL1A1
Gene Synonym:OI4
Exon (14)1030..1083
Gene:COL1A1
Gene Synonym:OI4
Exon (15)1084..1128
Gene:COL1A1
Gene Synonym:OI4
Exon (16)1129..1182
Gene:COL1A1
Gene Synonym:OI4
Exon (17)1183..1281
Gene:COL1A1
Gene Synonym:OI4
Exon (18)1282..1326
Gene:COL1A1
Gene Synonym:OI4
Exon (19)1327..1425
Gene:COL1A1
Gene Synonym:OI4
Exon (20)1426..1479
Gene:COL1A1
Gene Synonym:OI4
Exon (21)1480..1587
Gene:COL1A1
Gene Synonym:OI4
Exon (22)1588..1641
Gene:COL1A1
Gene Synonym:OI4
Exon (23)1642..1740
Gene:COL1A1
Gene Synonym:OI4
Exon (24)1741..1794
Gene:COL1A1
Gene Synonym:OI4
Exon (25)1795..1893
Gene:COL1A1
Gene Synonym:OI4
Exon (26)1894..1947
Gene:COL1A1
Gene Synonym:OI4
Exon (27)1948..2001
Gene:COL1A1
Gene Synonym:OI4
Exon (28)2002..2055
Gene:COL1A1
Gene Synonym:OI4
Exon (29)2056..2109
Gene:COL1A1
Gene Synonym:OI4
Exon (30)2110..2154
Gene:COL1A1
Gene Synonym:OI4
Exon (31)2155..2253
Gene:COL1A1
Gene Synonym:OI4
Exon (32)2254..2361
Gene:COL1A1
Gene Synonym:OI4
Exon (33)2362..2469
Gene:COL1A1
Gene Synonym:OI4
Exon (34)2470..2523
Gene:COL1A1
Gene Synonym:OI4
Exon (35)2524..2577
Gene:COL1A1
Gene Synonym:OI4
Exon (36)2578..2685
Gene:COL1A1
Gene Synonym:OI4
Exon (37)2686..2739
Gene:COL1A1
Gene Synonym:OI4
Exon (38)2740..2793
Gene:COL1A1
Gene Synonym:OI4
Exon (39)2794..2955
Gene:COL1A1
Gene Synonym:OI4
Exon (40)2956..3063
Gene:COL1A1
Gene Synonym:OI4
Exon (41)3064..3171
Gene:COL1A1
Gene Synonym:OI4
Exon (42)3172..3225
Gene:COL1A1
Gene Synonym:OI4
Exon (43)3226..3333
Gene:COL1A1
Gene Synonym:OI4
Exon (44)3334..3387
Gene:COL1A1
Gene Synonym:OI4
Exon (45)3388..3495
Gene:COL1A1
Gene Synonym:OI4
Exon (46)3496..3549
Gene:COL1A1
Gene Synonym:OI4
Exon (47)3550..3657
Gene:COL1A1
Gene Synonym:OI4
Exon (48)3658..3940
Gene:COL1A1
Gene Synonym:OI4
Exon (49)3941..4131
Gene:COL1A1
Gene Synonym:OI4
Exon (50)4132..4374
Gene:COL1A1
Gene Synonym:OI4
Exon (51)4375..5927
Gene:COL1A1
Gene Synonym:OI4
Translation MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRI CVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPR GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGP MGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGR PGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQ MGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGP RGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGP QGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGL PGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGL TGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGV PGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGE QGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGS QGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGD KGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGP PGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGP AGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGV VGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGA EGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPVGP VGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGP RGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF LPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCR DLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKD KRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQ TGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPII DVAPLDVGAPDQEFGFDVGPVCFL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(70)-dbSNP:
complement(70)-g, adbSNP:2734278
complement(86)-g, adbSNP:200106397
complement(104)-t, cdbSNP:200689194
complement(171)-g, adbSNP:140295356
complement(190)-g, cdbSNP:72667007
complement(197)-t, cdbSNP:201920416
complement(203)-t, cdbSNP:151171179
complement(259)-dbSNP:
complement(259)-g, cdbSNP:143230025
complement(303)-t, gdbSNP:1057297
complement(310)-t, cdbSNP:146431113
complement(372)-, cdbSNP:72667010
complement(385)-g, adbSNP:143980299
complement(425..426)-dbSNP:
complement(425..426)-, agdbSNP:193922154
complement(425..426)-, cdbSNP:72667011
complement(459)-g, adbSNP:2857400
complement(485)-dbSNP:
complement(485)-t, cdbSNP:35183627
complement(512)-dbSNP:
complement(512)-, cdbSNP:72667014
complement(515..516)-, adbSNP:72667015
complement(558)-, cdbSNP:72667016
complement(585)-, tdbSNP:72667017
complement(588)-t, cdbSNP:41317351
complement(643)-dbSNP:
complement(643)-t, gdbSNP:193922157
complement(658)-, cdbSNP:72667021
complement(669)-g, adbSNP:72667022
complement(687)-dbSNP:
complement(687)-g, adbSNP:148596229
complement(698)-g, c, adbSNP:67828806
complement(705)-, tdbSNP:72667023
complement(706)-g, cdbSNP:72667024
complement(715)-dbSNP:
complement(715)-t, g, adbSNP:8179178
complement(716)-g, adbSNP:72667028
complement(725)-t, gdbSNP:72667029
complement(733)-g, cdbSNP:72667030
complement(734)-t, gdbSNP:72667031
complement(738)-g, adbSNP:138078016
complement(739)-g, cdbSNP:72667032
complement(740)-, cdbSNP:72667033
complement(753)-g, adbSNP:201136122
complement(760)-g, adbSNP:72667034
complement(778..779)-dbSNP:
complement(778..779)-, cdbSNP:35238867
complement(784)-t, cdbSNP:72667036
complement(785)-t, cdbSNP:200142836
complement(787)-t, gdbSNP:72667037
complement(796)-t, gdbSNP:72667038
complement(842)-dbSNP:
complement(842)-g, adbSNP:72645314
complement(851)-g, adbSNP:72645315
complement(866)-g, adbSNP:199626372
complement(868)-g, adbSNP:72645316
complement(877)-dbSNP:
complement(877)-t, gdbSNP:72645317
complement(883)-t, cdbSNP:72645318
complement(886)-g, adbSNP:72645319
complement(887)-g, adbSNP:72645320
complement(894)-g, adbSNP:199891984
complement(895)-g, adbSNP:72645321
complement(901)-, gdbSNP:72645322
complement(913)-g, adbSNP:72645323
complement(914)-t, gdbSNP:72645324
complement(923)-g, adbSNP:72645325
complement(931)-dbSNP:
complement(931)-g, adbSNP:72645328
complement(932)-t, gdbSNP:72645329
complement(934)-, tdbSNP:72645330
complement(940)-t, gdbSNP:72645331
complement(949)-g, cdbSNP:72645332
complement(950)-g, adbSNP:72645333
complement(967)-g, adbSNP:72645334
complement(968)-g, adbSNP:72645335
complement(976)-g, adbSNP:72645336
complement(977)-g, cdbSNP:72645337
complement(985)-dbSNP:
complement(985)-g, adbSNP:72645340
complement(988)-g, adbSNP:72645341
complement(1000)-g, adbSNP:139840296
complement(1021)-g, cdbSNP:72645342
complement(1022)-g, adbSNP:72645343
complement(1039)-dbSNP:
complement(1039)-g, c, adbSNP:68062484
complement(1057)-g, cdbSNP:72645345
complement(1058)-g, adbSNP:72645346
complement(1060)-t, cdbSNP:72645347
complement(1066)-g, adbSNP:72645348
complement(1085)-dbSNP:
complement(1085)-t, gdbSNP:72645353
complement(1094)-g, adbSNP:72645354
complement(1102)-g, adbSNP:72645355
complement(1103)-g, adbSNP:72645356
complement(1119)-g, adbSNP:147277057
complement(1120)-g, adbSNP:72645357
complement(1121)-g, cdbSNP:72645358
complement(1125)-g, adbSNP:62637627
complement(1126..1127)-, gdbSNP:150572711
complement(1134)-dbSNP:
complement(1134)-g, adbSNP:200750214
complement(1138)-t, g, adbSNP:66664580
complement(1147)-t, gdbSNP:193922137
complement(1168)-t, cdbSNP:139955975
complement(1171)-t, gdbSNP:72645362
complement(1174)-g, cdbSNP:72645363
complement(1183)-dbSNP:
complement(1183)-t, g, adbSNP:66721653
complement(1192)-t, gdbSNP:72645365
complement(1207)-t, cdbSNP:72645366
complement(1220)-t, g, cdbSNP:66494876
complement(1228)-g, adbSNP:72645367
complement(1233)-t, cdbSNP:144889918
complement(1237)-g, adbSNP:72645368
complement(1253)-, cdbSNP:72645369
complement(1254)-, tdbSNP:72645370
complement(1256)-g, cdbSNP:72645371
complement(1264)-t, gdbSNP:72648313
complement(1265)-t, gdbSNP:72648314
complement(1273)-t, g, adbSNP:67182491
complement(1291)-dbSNP:
complement(1291)-t, g, c, adbSNP:66548636
complement(1294)-t, cdbSNP:116794104
complement(1301)-g, adbSNP:72648317
complement(1309)-g, adbSNP:72648318
complement(1318)-t, gdbSNP:72648319
complement(1319)-g, c, adbSNP:66501246
complement(1327)-dbSNP:
complement(1327)-t, gdbSNP:72648322
complement(1328)-g, adbSNP:72648323
complement(1332)-c, adbSNP:141411256
complement(1335)-g, adbSNP:200786825
complement(1336)-t, g, adbSNP:66893386
complement(1345)-t, g, adbSNP:66761141
complement(1354)-g, adbSNP:72648324
complement(1359)-g, adbSNP:148073433
complement(1361)-g, cdbSNP:193922138
complement(1364)-g, cdbSNP:72648325
complement(1369)-t, cdbSNP:72648326
complement(1375)-g, cdbSNP:72648327
complement(1390)-t, gdbSNP:72648328
complement(1391)-g, cdbSNP:72648329
complement(1395)-g, adbSNP:149301001
complement(1399)-g, adbSNP:72648330
complement(1408)-t, gdbSNP:72648331
complement(1418)-t, gdbSNP:72648332
complement(1427)-dbSNP:
complement(1427)-t, gdbSNP:72648333
complement(1489)-dbSNP:
complement(1489)-t, gdbSNP:72648339
complement(1507)-g, adbSNP:72648340
complement(1516)-g, adbSNP:72648341
complement(1517)-g, adbSNP:72648342
complement(1540)-t, cdbSNP:72648343
complement(1551)-g, adbSNP:200778332
complement(1552)-t, g, cdbSNP:57377812
complement(1566)-c, adbSNP:186025135
complement(1570)-g, adbSNP:72648344
complement(1571)-g, cdbSNP:72648345
complement(1578)-, tdbSNP:72648346
complement(1591)-dbSNP:
complement(1591)-t, cdbSNP:138570309
complement(1597)-t, gdbSNP:72648348
complement(1612..1613)-, ccdbSNP:72648349
complement(1633)-t, gdbSNP:72648350
complement(1670)-dbSNP:
complement(1670)-g, cdbSNP:193922140
complement(1674)-t, cdbSNP:1007085
complement(1705)-t, gdbSNP:72648353
complement(1706)-g, cdbSNP:72648354
complement(1709)-t, cdbSNP:144751329
complement(1713)-g, adbSNP:113437353
complement(1714)-t, g, adbSNP:67682641
complement(1723)-t, gdbSNP:72648355
complement(1724)-g, adbSNP:72648356
complement(1764)-g, adbSNP:146450504
complement(1783)-, adbSNP:193922141
complement(1787)-g, cdbSNP:72648358
complement(1790)-g, cdbSNP:72648359
1794..1795+, cdbSNP:72648361
complement(1794)-, tdbSNP:72648360
complement(1804)-dbSNP:
complement(1804)-t, g, c, adbSNP:67507747
complement(1817)-g, adbSNP:1800211
complement(1822)-g, c, adbSNP:67416837
complement(1831)-g, cdbSNP:72648363
complement(1838)-g, adbSNP:5028520
complement(1845..1846)-, acdbSNP:72648364
complement(1846)-t, cdbSNP:72648365
complement(1867)-g, adbSNP:72648366
complement(1885)-g, adbSNP:72648367
complement(1886)-g, cdbSNP:72648368
complement(1890)-t, cdbSNP:1800212
complement(1897)-dbSNP:
complement(1897)-g, adbSNP:1135345
complement(1903)-t, g, adbSNP:66527965
complement(1904)-g, adbSNP:72651613
complement(1918)-t, cdbSNP:72651614
complement(1929)-g, adbSNP:148275339
complement(1930)-g, adbSNP:72651615
complement(1938)-, tdbSNP:193922143
complement(1938)-g, adbSNP:151328660
complement(1940)-, gdbSNP:72651616
complement(1947)-t, cdbSNP:41316667
complement(1963)-dbSNP:
complement(1963)-t, cdbSNP:143145612
complement(1971..1973)-, ggcdbSNP:72651618
complement(1975)-g, adbSNP:72651619
complement(1991)-, cdbSNP:72651620
complement(1992)-, tdbSNP:72651621
complement(1999)-t, cdbSNP:149561221
complement(2002)-dbSNP:
complement(2002)-t, g, adbSNP:68181175
complement(2007)-g, adbSNP:147727026
complement(2008)-t, cdbSNP:113950465
complement(2011)-, gdbSNP:66489346
complement(2011)-g, adbSNP:66489345
complement(2029)-g, adbSNP:72651624
complement(2039)-t, gdbSNP:72651625
complement(2046)-g, adbSNP:140024722
complement(2065)-dbSNP:
complement(2065)-g, adbSNP:72651627
complement(2070)-, tdbSNP:72651628
complement(2074)-g, cdbSNP:72651626
complement(2092)-g, adbSNP:72651629
complement(2102)-g, cdbSNP:72651630
complement(2107)-t, cdbSNP:72651631
complement(2120)-dbSNP:
complement(2120)-, gdbSNP:72651633
complement(2136)-, tdbSNP:72651634
complement(2160)-dbSNP:
complement(2160)-g, cdbSNP:147483404
complement(2172..2173)-, ctctctagdbSNP:74315115
complement(2173)-g, adbSNP:72651636
complement(2175)-g, cdbSNP:149352055
complement(2183)-t, gdbSNP:72651637
complement(2188)-t, cdbSNP:193922144
complement(2191)-g, adbSNP:72651638
complement(2198)-, cdbSNP:72651639
complement(2199)-, tdbSNP:72651640
complement(2210)-, gdbSNP:72651641
complement(2211)-t, adbSNP:1800213
complement(2215)-t, cdbSNP:72651642
complement(2216)-t, cdbSNP:202221716
complement(2220)-t, cdbSNP:139673121
complement(2223)-, cdbSNP:72651643
complement(2226)-g, adbSNP:201122145
complement(2227)-t, g, adbSNP:68114505
complement(2236)-t, g, adbSNP:67368147
complement(2241)-t, cdbSNP:41316673
complement(2281)-dbSNP:
complement(2281)-g, adbSNP:72651645
complement(2282)-g, adbSNP:72651646
complement(2287)-t, cdbSNP:193922145
complement(2290)-g, adbSNP:72651647
complement(2292)-g, adbSNP:200188855
complement(2293)-t, cdbSNP:150803124
complement(2301)-t, cdbSNP:35017779
complement(2308)-g, adbSNP:72651648
complement(2327)-t, gdbSNP:72651649
complement(2335)-t, gdbSNP:72651650
complement(2336)-g, adbSNP:72651651
complement(2353)-g, adbSNP:72651652
complement(2354)-t, gdbSNP:72651653
complement(2389)-dbSNP:
complement(2389)-g, adbSNP:72651654
complement(2394..2395)-, tcdbSNP:72651655
complement(2398)-t, gdbSNP:72651656
complement(2400)-g, adbSNP:200111312
complement(2410)-t, cdbSNP:138749826
complement(2414)-t, cdbSNP:144820445
complement(2417)-t, gdbSNP:72651657
complement(2424)-t, g, cdbSNP:2734272
complement(2425)-g, adbSNP:72651658
complement(2434)-t, g, adbSNP:67087075
complement(2443)-g, adbSNP:72651659
complement(2452)-g, adbSNP:72651660
complement(2461)-g, adbSNP:72651661
complement(2481)-dbSNP:
complement(2481)-t, adbSNP:137937544
complement(2488)-t, g, adbSNP:67879854
complement(2513)-g, adbSNP:72651662
complement(2540)-dbSNP:
complement(2540)-g, adbSNP:145307365
complement(2544)-, tdbSNP:193922148
complement(2551)-g, adbSNP:72651663
complement(2570)-t, g, cdbSNP:66929517
complement(2570)-, gdbSNP:66929519
complement(2576)-, cdbSNP:193922149
complement(2577)-, tdbSNP:72651664
complement(2587)-dbSNP:
complement(2587)-g, c, adbSNP:67693970
complement(2590)-t, cdbSNP:72651668
complement(2593)-g, cdbSNP:1800214
complement(2596)-t, gdbSNP:72651669
complement(2606)-g, adbSNP:72653129
complement(2608)-t, cdbSNP:199510546
complement(2624)-t, g, adbSNP:67067133
complement(2633)-g, cdbSNP:72653130
complement(2634)-g, adbSNP:200620805
complement(2636..2651)-, atgctggtccccctggdbSNP:74315116
complement(2641)-g, adbSNP:72653131
complement(2642)-g, adbSNP:72653132
complement(2649)-, tdbSNP:72653133
complement(2650)-g, cdbSNP:72653134
complement(2651)-g, adbSNP:72653135
complement(2659)-g, adbSNP:72653136
complement(2678)-g, adbSNP:72653137
complement(2686)-dbSNP:
complement(2686)-g, adbSNP:72653140
complement(2695)-t, gdbSNP:72653141
complement(2705)-g, cdbSNP:72653142
complement(2720)-g, adbSNP:193922150
complement(2721)-g, adbSNP:117672175
complement(2722)-t, g, adbSNP:67445413
complement(2731)-t, gdbSNP:72653143
complement(2739)-, tdbSNP:72653144
complement(2749)-dbSNP:
complement(2749)-g, adbSNP:72653145
complement(2758)-g, adbSNP:72653146
complement(2770)-t, cdbSNP:72653147
complement(2772..2773)-, agdbSNP:72653148
complement(2785)-g, adbSNP:72653149
complement(2810)-dbSNP:
complement(2810)-, cdbSNP:72653151
complement(2811)-, tdbSNP:193922151
complement(2812)-t, gdbSNP:72653152
complement(2842)-t, cdbSNP:145446512
complement(2876)-g, adbSNP:72653153
complement(2879)-t, cdbSNP:181824088
complement(2896)-g, adbSNP:200990242
complement(2902)-t, gdbSNP:72653154
complement(2905)-g, adbSNP:150082497
complement(2910)-, tdbSNP:72653155
complement(2956)-dbSNP:
complement(2956)-t, gdbSNP:72653158
complement(2965)-t, gdbSNP:72653159
complement(2974)-g, adbSNP:72653160
complement(2995)-t, cdbSNP:72653161
complement(2999)-t, gdbSNP:72653162
complement(3011)-g, adbSNP:72653163
complement(3023)-g, adbSNP:193922152
complement(3047)-g, adbSNP:72653164
complement(3058)-t, cdbSNP:193922153
complement(3065)-dbSNP:
complement(3065)-t, gdbSNP:72653166
complement(3070)-t, gdbSNP:141117382
complement(3075)-t, gdbSNP:201236489
complement(3103)-c, adbSNP:62062995
complement(3127)-t, gdbSNP:72653167
complement(3134)-, cdbSNP:72653168
complement(3154)-g, adbSNP:72653169
complement(3166)-t, cdbSNP:72653170
complement(3182)-dbSNP:
complement(3182)-g, cdbSNP:1135348
complement(3187)-g, cdbSNP:139593707
complement(3190)-, gdbSNP:66523074
complement(3190)-g, adbSNP:66523073
complement(3191)-t, g, cdbSNP:67771061
complement(3199)-g, adbSNP:72653172
complement(3202)-t, cdbSNP:72653173
complement(3205)-, gdbSNP:72653174
complement(3208)-g, adbSNP:72653175
complement(3228)-dbSNP:
complement(3228)-g, adbSNP:147743501
complement(3232)-t, cdbSNP:72653177
complement(3244)-g, adbSNP:72653178
complement(3249)-g, adbSNP:145608939
complement(3262)-t, g, adbSNP:68181904
complement(3271)-g, adbSNP:67641695
complement(3280)-g, adbSNP:72653179
complement(3281..3289)-, gtgcccctgdbSNP:74315123
complement(3283..3284)-, ctggtggtcdbSNP:74315149
complement(3288)-, tdbSNP:72654794
complement(3298)-g, adbSNP:72654795
complement(3307)-g, adbSNP:72654796
complement(3308)-g, adbSNP:72654797
complement(3317)-g, cdbSNP:72654798
complement(3322)-t, cdbSNP:72654799
complement(3327)-, tdbSNP:72654800
complement(3340)-dbSNP:
complement(3340)-t, gdbSNP:11556513
complement(3349)-g, adbSNP:1800215
complement(3352)-t, g, adbSNP:67394386
complement(3361)-g, adbSNP:72654802
complement(3366)-t, cdbSNP:1800216
complement(3369)-t, cdbSNP:1800217
complement(3370)-t, gdbSNP:72656303
complement(3379)-g, adbSNP:72656304
complement(3384)-g, adbSNP:200319927
complement(3389)-dbSNP:
complement(3389)-g, cdbSNP:72656305
complement(3397)-g, adbSNP:72656306
complement(3402)-t, gdbSNP:17853658
complement(3403)-t, cdbSNP:72656307
complement(3425)-g, adbSNP:72656308
complement(3435)-g, adbSNP:142312753
complement(3439)-, adbSNP:72656310
complement(3443)-g, cdbSNP:72656311
complement(3496)-dbSNP:
complement(3496)-t, gdbSNP:72656312
complement(3507)-g, adbSNP:111738740
complement(3528)-, cdbSNP:72656313
complement(3547)-t, cdbSNP:72656314
complement(3548)-g, adbSNP:41316713
complement(3549)-t, gdbSNP:148737409
complement(3550)-dbSNP:
complement(3550)-g, adbSNP:72656317
complement(3559)-t, gdbSNP:72656318
complement(3560)-g, adbSNP:72656319
complement(3577)-g, adbSNP:72656320
complement(3578)-t, gdbSNP:72656321
complement(3585)-t, cdbSNP:1800218
complement(3586)-g, cdbSNP:72656322
complement(3594)-g, adbSNP:149980662
complement(3596)-g, adbSNP:72656323
complement(3600)-g, adbSNP:201679090
complement(3621)-c, adbSNP:139996062
complement(3622)-t, gdbSNP:72656324
complement(3631)-t, g, adbSNP:67815019
complement(3641)-g, adbSNP:72656325
complement(3649)-t, g, adbSNP:67762345
complement(3655)-g, adbSNP:41316719
complement(3659)-dbSNP:
complement(3659)-t, gdbSNP:72656329
complement(3666)-g, adbSNP:146016027
complement(3667)-g, adbSNP:72656330
complement(3677)-t, gdbSNP:72656331
complement(3685)-g, adbSNP:72656332
complement(3686)-t, gdbSNP:66948146
complement(3686)-, gdbSNP:66948145
complement(3697)-g, cdbSNP:142570406
complement(3706..3707)-, gcdbSNP:72656333
3709+g, tdbSNP:72656334
complement(3710)-, gdbSNP:72656335
complement(3715..3716)-, gadbSNP:72656336
complement(3767)-t, cdbSNP:137987935
complement(3778)-g, adbSNP:72656337
complement(3779)-t, gdbSNP:201398339
complement(3781)-g, adbSNP:72656338
complement(3783)-t, gdbSNP:72656339
complement(3786)-c, adbSNP:150751153
complement(3810)-g, adbSNP:141219921
complement(3859)-t, adbSNP:199514372
complement(3876)-t, gdbSNP:2586487
complement(3878)-g, cdbSNP:3205325
complement(3892)-t, cdbSNP:148216434
complement(3898)-t, gdbSNP:202131429
complement(3908..3920)-, acctcaagatgtgdbSNP:74315166
complement(3916)-g, adbSNP:72656340
complement(3932)-g, adbSNP:72656341
complement(3955)-g, cdbSNP:72656342
complement(3975)-t, gdbSNP:199911681
complement(4002)-g, adbSNP:143049736
complement(4023)-t, g, cdbSNP:34940368
complement(4024)-t, cdbSNP:192986202
complement(4032)-g, adbSNP:188887858
complement(4040)-g, adbSNP:201746814
complement(4062)-t, gdbSNP:72656343
complement(4091)-t, cdbSNP:138544681
complement(4093)-t, cdbSNP:72656344
complement(4100)-g, adbSNP:72656345
complement(4104)-g, adbSNP:200145743
complement(4105)-t, cdbSNP:147104425
complement(4108)-t, cdbSNP:142128554
complement(4114)-t, cdbSNP:201070506
complement(4119)-g, adbSNP:148659814
complement(4134..4139)-dbSNP:
complement(4134..4139)-, cgagtadbSNP:72656346
complement(4143)-t, gdbSNP:201256042
complement(4144)-t, cdbSNP:147936946
complement(4165)-t, cdbSNP:191166865
complement(4180)-, cdbSNP:72656347
complement(4190)-g, adbSNP:113005305
complement(4193)-t, cdbSNP:149820303
complement(4207)-g, cdbSNP:141011435
complement(4239)-g, adbSNP:41316723
complement(4261)-c, adbSNP:3205509
complement(4289)-t, gdbSNP:72656348
complement(4297)-t, gdbSNP:2586486
complement(4305)-t, cdbSNP:1800219
complement(4307)-t, cdbSNP:147266928
complement(4322)-t, cdbSNP:146035171
complement(4334)-t, gdbSNP:77448028
complement(4335..4336)-, gggdbSNP:145381116
complement(4363)-g, adbSNP:72656349
complement(4383)-dbSNP:
complement(4383)-g, adbSNP:144134990
complement(4384)-t, cdbSNP:139388334
complement(4401)-t, adbSNP:10407
complement(4407)-t, cdbSNP:41316725
complement(4417)-c, adbSNP:1059454
complement(4422)-c, adbSNP:1059475
complement(4426)-t, adbSNP:1800220
complement(4433)-t, cdbSNP:149295671
complement(4436)-t, adbSNP:72656350
complement(4439)-g, cdbSNP:17857117
complement(4447)-t, gdbSNP:72656351
complement(4484..4488)-, aattcdbSNP:72656352
complement(4497)-g, adbSNP:112873723
complement(4498)-t, cdbSNP:138557594
complement(4505)-t, gdbSNP:17853657
complement(4517)-t, cdbSNP:72656353
complement(4535)-c, adbSNP:1064882
complement(4537)-t, cdbSNP:202170631
complement(4541)-t, cdbSNP:199806909
complement(4542)-g, cdbSNP:201085309
complement(4553)-g, adbSNP:11556514
complement(4579)-t, gdbSNP:10144
complement(4609)-t, cdbSNP:1061237
complement(4623)-t, adbSNP:182302582
complement(4745..4746)-, tt, tttdbSNP:66504954
complement(4753..4754)-, ttt, ttttdbSNP:66686086
complement(4754..4755)-, tt, tttdbSNP:67561466
complement(4764..4765)-, ttdbSNP:56302025
complement(4829)-, cdbSNP:200011356
complement(4899)-g, cdbSNP:148131473
complement(4907)-, cdbSNP:35582215
complement(5000)-g, adbSNP:75168103
complement(5199..5200)-, cttgdbSNP:71748188
complement(5200..5201)-, cttgdbSNP:3840870
complement(5201..5202)-, gctt, tgctdbSNP:35521741
complement(5202..5203)-, tgctdbSNP:112626388
complement(5203..5204)-, cttgdbSNP:141556853
complement(5203)-t, gdbSNP:77720683
complement(5204)-c, adbSNP:199723627
complement(5265)-t, cdbSNP:1061947
complement(5281)-, cdbSNP:111435223
complement(5406)-t, gdbSNP:62062994
complement(5528)-t, cdbSNP:201245980
complement(5532)-t, cdbSNP:1061970
complement(5546..5547)-, aadbSNP:58879635
complement(5547..5549)-, acadbSNP:71708744
complement(5547)-, aadbSNP:71701501
complement(5548)-c, adbSNP:200882287
complement(5609)-t, cdbSNP:191326459
complement(5674)-t, cdbSNP:1062135
complement(5686)-g, cdbSNP:149419718
complement(5696)-c, adbSNP:75713851
complement(5712)-t, gdbSNP:34162544
complement(5747..5748)-, acdbSNP:71699277
complement(5754)-t, cdbSNP:73987442
complement(5766)-g, adbSNP:145188105
complement(5829)-t, cdbSNP:12944834
complement(5886)-c, adbSNP:12937105
complement(5920)-t, cdbSNP:188154578
Gene SymbolCOL1A1
Gene SynonymOI4
Chromosome17
Locus Map17q21.33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000088 Homo sapiens collagen, type I, alpha 1 (COL1A1), mRNA. On-demand $1699.00 25
Title Association between osteoporosis and polymorphisms of the bone Gla protein, estrogen receptor 1, collagen 1-A1 and calcitonin receptor genes in Turkish postmenopausal women .
Author Tural,S., Kara,N., Alayli,G. and Tomak,L.
Journal Gene 515 (1), 167-172 (2013)
Title Elevated pre-operative serum peptides for collagen I and III synthesis result in post-surgical atrial fibrillation .
Author Swartz,M.F., Fink,G.W., Sarwar,M.F., Hicks,G.L., Yu,Y., Hu,R., Lutz,C.J., Taffet,S.M. and Jalife,J.
Journal J. Am. Coll. Cardiol. 60 (18), 1799-1806 (2012)
Title Fibrillar type I collagen matrices enhance metastasis/invasion of ovarian epithelial cancer via beta1 integrin and PTEN signals .
Author Shen,Y., Shen,R., Ge,L., Zhu,Q. and Li,F.
Journal Int. J. Gynecol. Cancer 22 (8), 1316-1324 (2012)
Title Inhibitory effects of the transcription factor Ets-1 on the expression of type I collagen in TGF-beta1-stimulated renal epithelial cells .
Author Okano,K., Hibi,A., Miyaoka,T., Inoue,T., Sugimoto,H., Tsuchiya,K., Akiba,T. and Nitta,K.
Journal Mol. Cell. Biochem. 369 (1-2), 247-254 (2012)
Title Variable expressivity of osteogenesis imperfecta in a Brazilian family due to p.G1079S mutation in the COL1A1 gene .
Author Moraes,M.V., Milanez,M., Almada,B.V., Sipolatti,V., Reboucas,M.R., Nunes,V.R., Akel,A.N. Jr., Zatz,M., Errera,F.I., Louro,I.D. and Paula,F.
Journal Genet. Mol. Res. 11 (3), 3246-3255 (2012)
Title A tripeptide deletion in the triple-helical domain of the pro alpha 1(I) chain of type I procollagen in a patient with lethal osteogenesis imperfecta does not alter cleavage of the molecule by N-proteinase .
Author Wallis,G.A., Kadler,K.E., Starman,B.J. and Byers,P.H.
Journal J. Biol. Chem. 267 (35), 25529-25534 (1992)
Title Activation of expression of genes coding for extracellular matrix proteins in Tat-producing glioblastoma cells .
Author Taylor,J.P., Cupp,C., Diaz,A., Chowdhury,M., Khalili,K., Jimenez,S.A. and Amini,S.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (20), 9617-9621 (1992)
Title Short amino acid sequences derived from C1q receptor (C1q-R) show homology with the alpha chains of fibronectin and vitronectin receptors and collagen type IV .
Author Ghebrehiwet,B., Peerschke,E.I., Hong,Y., Munoz,P. and Gorevic,P.D.
Journal J. Leukoc. Biol. 51 (6), 546-556 (1992)
Title Evidence for a relationship between Ehlers-Danlos type VII C in humans and bovine dermatosparaxis .
Author Nusgens,B.V., Verellen-Dumoulin,C., Hermanns-Le,T., De Paepe,A., Nuytinck,L., Pierard,G.E. and Lapiere,C.M.
Journal Nat. Genet. 1 (3), 214-217 (1992)
Title Defective folding and stable association with protein disulfide isomerase/prolyl hydroxylase of type I procollagen with a deletion in the pro alpha 2(I) chain that preserves the Gly-X-Y repeat pattern .
Author Chessler,S.D. and Byers,P.H.
Journal J. Biol. Chem. 267 (11), 7751-7757 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.