• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens collagen, type IV, alpha 3 (Goodpasture antigen) (COL4A3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000091 Homo sapiens collagen, type IV, alpha 3 (Goodpasture antigen) (COL4A3), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000091.4, 297632355
Length 8114 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens collagen, type IV, alpha 3 (Goodpasture antigen) (COL4A3), mRNA.
Product collagen alpha-3(IV) chain precursor
Comment

Summary: Type IV collagen, the major structural component of basement membranes, is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. This gene encodes alpha 3. In the Goodpasture syndrome, autoantibodies bind to the collagen molecules in the basement membranes of alveoli and glomeruli. The epitopes that elicit these autoantibodies are localized largely to the non-collagenous C-terminal domain of the protein. A specific kinase phosphorylates amino acids in this same C-terminal region and the expression of this kinase is upregulated during pathogenesis. This gene is also linked to an autosomal recessive form of Alport syndrome. The mutations contributing to this syndrome are also located within the exons that encode this C-terminal region. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter. [provided by RefSeq, Jun 2010].

RefSeq NP_000082.2
CDS 163..5175
Misc Feature(1)112..114
Misc Feature(2)112..114
Misc Feature(3)247..288
Misc Feature(4)289..4476
Misc Feature(5)1024..1179
Misc Feature(6)2533..2541
Misc Feature(7)2650..2829
Misc Feature(8)3148..3156
Misc Feature(9)3622..3630
Misc Feature(10)4078..4086
Misc Feature(11)4195..4203
Misc Feature(12)4438..4443
Misc Feature(13)4441..4494
Misc Feature(14)4456..4464
Misc Feature(15)4495..4824
Misc Feature(16)4597..4833
Misc Feature(17)4825..5163
Misc Feature(18)4990..5046
Exon (1)1..249
Gene:COL4A3
Gene Synonym:COL4A3
Exon (2)250..306
Gene:COL4A3
Gene Synonym:COL4A3
Exon (3)307..396
Gene:COL4A3
Gene Synonym:COL4A3
Exon (4)397..441
Gene:COL4A3
Gene Synonym:COL4A3
Exon (5)442..486
Gene:COL4A3
Gene Synonym:COL4A3
Exon (6)487..549
Gene:COL4A3
Gene Synonym:COL4A3
Exon (7)550..603
Gene:COL4A3
Gene Synonym:COL4A3
Exon (8)604..630
Gene:COL4A3
Gene Synonym:COL4A3
Exon (9)631..708
Gene:COL4A3
Gene Synonym:COL4A3
Exon (10)709..771
Gene:COL4A3
Gene Synonym:COL4A3
Exon (11)772..807
Gene:COL4A3
Gene Synonym:COL4A3
Exon (12)808..849
Gene:COL4A3
Gene Synonym:COL4A3
Exon (13)850..927
Gene:COL4A3
Gene Synonym:COL4A3
Exon (14)928..990
Gene:COL4A3
Gene Synonym:COL4A3
Exon (15)991..1050
Gene:COL4A3
Gene Synonym:COL4A3
Exon (16)1051..1095
Gene:COL4A3
Gene Synonym:COL4A3
Exon (17)1096..1149
Gene:COL4A3
Gene Synonym:COL4A3
Exon (18)1150..1191
Gene:COL4A3
Gene Synonym:COL4A3
Exon (19)1192..1276
Gene:COL4A3
Gene Synonym:COL4A3
Exon (20)1277..1312
Gene:COL4A3
Gene Synonym:COL4A3
Exon (21)1313..1477
Gene:COL4A3
Gene Synonym:COL4A3
Exon (22)1478..1570
Gene:COL4A3
Gene Synonym:COL4A3
Exon (23)1571..1666
Gene:COL4A3
Gene Synonym:COL4A3
Exon (24)1667..1737
Gene:COL4A3
Gene Synonym:COL4A3
Exon (25)1738..1920
Gene:COL4A3
Gene Synonym:COL4A3
Exon (26)1921..2089
Gene:COL4A3
Gene Synonym:COL4A3
Exon (27)2090..2182
Gene:COL4A3
Gene Synonym:COL4A3
Exon (28)2183..2287
Gene:COL4A3
Gene Synonym:COL4A3
Exon (29)2288..2385
Gene:COL4A3
Gene Synonym:COL4A3
Exon (30)2386..2536
Gene:COL4A3
Gene Synonym:COL4A3
Exon (31)2537..2650
Gene:COL4A3
Gene Synonym:COL4A3
Exon (32)2651..2818
Gene:COL4A3
Gene Synonym:COL4A3
Exon (33)2819..2908
Gene:COL4A3
Gene Synonym:COL4A3
Exon (34)2909..3043
Gene:COL4A3
Gene Synonym:COL4A3
Exon (35)3044..3142
Gene:COL4A3
Gene Synonym:COL4A3
Exon (36)3143..3232
Gene:COL4A3
Gene Synonym:COL4A3
Exon (37)3233..3372
Gene:COL4A3
Gene Synonym:COL4A3
Exon (38)3373..3499
Gene:COL4A3
Gene Synonym:COL4A3
Exon (39)3500..3580
Gene:COL4A3
Gene Synonym:COL4A3
Exon (40)3581..3679
Gene:COL4A3
Gene Synonym:COL4A3
Exon (41)3680..3727
Gene:COL4A3
Gene Synonym:COL4A3
Exon (42)3728..3913
Gene:COL4A3
Gene Synonym:COL4A3
Exon (43)3914..4044
Gene:COL4A3
Gene Synonym:COL4A3
Exon (44)4045..4117
Gene:COL4A3
Gene Synonym:COL4A3
Exon (45)4118..4189
Gene:COL4A3
Gene Synonym:COL4A3
Exon (46)4190..4315
Gene:COL4A3
Gene Synonym:COL4A3
Exon (47)4316..4414
Gene:COL4A3
Gene Synonym:COL4A3
Exon (48)4415..4624
Gene:COL4A3
Gene Synonym:COL4A3
Exon (49)4625..4802
Gene:COL4A3
Gene Synonym:COL4A3
Exon (50)4803..4917
Gene:COL4A3
Gene Synonym:COL4A3
Exon (51)4918..5090
Gene:COL4A3
Gene Synonym:COL4A3
Exon (52)5091..8097
Gene:COL4A3
Gene Synonym:COL4A3
Translation MSARTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSP GQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLV GVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPG PQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGP PGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPG KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPG PPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCP YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEK GETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGD PGSPGSPGPAGPAGPPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGP PGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSL GCPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPG TPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGD PGIPGLDRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAI GPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLK GFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNM GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG KKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPPG LPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPGFP GLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPG SHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGE KGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP PGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPAT WTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTM PFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAV HSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRG TCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
233+c, gdbSNP:184704920
235+c, tdbSNP:139271412
274+dbSNP:
274+c, gdbSNP:201607115
289+c, gdbSNP:13424243
298+a, gdbSNP:200866082
334+dbSNP:
334+a, gdbSNP:184730597
366+c, tdbSNP:200170381
384+a, gdbSNP:187950806
395+a, gdbSNP:13405977
436+dbSNP:
436+c, gdbSNP:200873401
445+dbSNP:
445+a, cdbSNP:201222896
486+a, tdbSNP:186323744
505+dbSNP:
505+a, gdbSNP:202147112
508+a, cdbSNP:115324397
561+dbSNP:
561+a, gdbSNP:75683214
584+c, tdbSNP:10178458
647+dbSNP:
647+a, gdbSNP:6436669
656+c, tdbSNP:144036466
675+c, tdbSNP:199514043
694+a, gdbSNP:188324379
848+dbSNP:
848+a, gdbSNP:188942711
903+dbSNP:
903+c, gdbSNP:199887536
967+dbSNP:
967+a, gdbSNP:80109666
1138+dbSNP:
1138+g, tdbSNP:55703767
1184+dbSNP:
1184+a, gdbSNP:200738124
1211+dbSNP:
1211+a, gdbSNP:201909310
1274+a, gdbSNP:199543633
1357+dbSNP:
1357+c, tdbSNP:10205042
1385+a, gdbSNP:34505188
1418+a, cdbSNP:201031986
1472+c, tdbSNP:148686474
1485+dbSNP:
1485+a, cdbSNP:73080086
1514+a, gdbSNP:11677877
1515+c, tdbSNP:189364374
1560+c, tdbSNP:145833114
1561+c, gdbSNP:201088233
1614+dbSNP:
1614+a, gdbSNP:34019152
1645+c, tdbSNP:200510532
1656+a, cdbSNP:200207635
1677+dbSNP:
1677+c, tdbSNP:200416402
1678+a, gdbSNP:188967260
1883+dbSNP:
1883+c, tdbSNP:28381984
2048+dbSNP:
2048+c, tdbSNP:139361545
2049+g, tdbSNP:201109911
2080+a, gdbSNP:200672668
2106+dbSNP:
2106+c, tdbSNP:199554662
2245+dbSNP:
2245+a, gdbSNP:200287952
2277+a, tdbSNP:201419174
2330+dbSNP:
2330+c, tdbSNP:201198284
2336+a, gdbSNP:199734116
2553+dbSNP:
2553+c, tdbSNP:187921460
2637+c, gdbSNP:192027050
2663+dbSNP:
2663+a, gdbSNP:56226424
2861+dbSNP:
2861+c, tdbSNP:201665434
2877+c, tdbSNP:75519005
2962+dbSNP:
2962+a, gdbSNP:199956740
2975+a, gdbSNP:202161876
2988+c, tdbSNP:201064766
3010+a, gdbSNP:200044988
3048+dbSNP:
3048+c, tdbSNP:77846212
3049+a, gdbSNP:200801946
3116+g, tdbSNP:121912827
3193+dbSNP:
3193+c, tdbSNP:73996408
3206+a, gdbSNP:121912826
3221+c, tdbSNP:202071907
3281+dbSNP:
3281+c, gdbSNP:187864249
3344+a, gdbSNP:202078295
3362+c, gdbSNP:55849096
3363+a, gdbSNP:191829138
3389+dbSNP:
3389+c, tdbSNP:200984988
3390+a, gdbSNP:200125890
3420+a, gdbSNP:147085074
3432+a, cdbSNP:201989155
3487+c, tdbSNP:55816283
3597+dbSNP:
3597+a, tdbSNP:191363114
3602+c, tdbSNP:200107989
3637+a, cdbSNP:142376694
3638+a, gdbSNP:145948549
3661+a, gdbSNP:267606745
3769+dbSNP:
3769+c, tdbSNP:200884685
3789+a, gdbSNP:200562865
3806+a, gdbSNP:200443942
3863+a, tdbSNP:55825399
3884+a, gdbSNP:201841428
3918+dbSNP:
3918+g, tdbSNP:112516617
3969+a, cdbSNP:57611801
3987+c, tdbSNP:143380907
3991+a, gdbSNP:190598500
4024+a, cdbSNP:202085686
4040+a, gdbSNP:201095498
4079+dbSNP:
4079+a, gdbSNP:57311286
4101+a, gdbSNP:141552752
4107+a, gdbSNP:189574905
4111+a, gdbSNP:200017859
4139+dbSNP:
4139+c, tdbSNP:201056180
4203+dbSNP:
4203+a, cdbSNP:73996414
4366+dbSNP:
4366+a, cdbSNP:199548916
4457+dbSNP:
4457+a, gdbSNP:200509072
4542+c, tdbSNP:114430490
4560+a, cdbSNP:184847026
4583+c, tdbSNP:200302125
4603+c, tdbSNP:121912824
4607+c, tdbSNP:199755408
4611+c, tdbSNP:140672401
4628+dbSNP:
4628+c, tdbSNP:200818438
4644+a, gdbSNP:181952966
4646+a, gdbSNP:77964815
4656+c, gdbSNP:200454769
4672+c, tdbSNP:201671013
4676+g, tdbSNP:74333012
4685+a, gdbSNP:200512461
4733+c, gdbSNP:121912825
4811+dbSNP:
4811+g, tdbSNP:200655479
4827+a, g, tdbSNP:200858199
4869+a, tdbSNP:113401495
5013+g, tdbSNP:74379096
5055+c, tdbSNP:183218622
5137+dbSNP:
5137+a, gdbSNP:193076251
5138+c, tdbSNP:75042602
5143+c, tdbSNP:201697532
5283+c, gdbSNP:200803393
5352+a, gdbSNP:139638980
5461+c, tdbSNP:6436677
5490+a, cdbSNP:2070735
5510+a, gdbSNP:115158745
5727+c, gdbSNP:112338364
5764+c, tdbSNP:55698424
5770+a, tdbSNP:56123646
5822+g, tdbSNP:183552783
5986+a, cdbSNP:116568659
6068+c, tdbSNP:7587228
6144+a, gdbSNP:188150740
6156+c, tdbSNP:1134745
6232..6233+, aadbSNP:59670450
6232+, a, aaadbSNP:11297279
6340+a, gdbSNP:28554165
6414+c, gdbSNP:10188531
6449+c, tdbSNP:192736312
6497+a, tdbSNP:115338903
6535+a, tdbSNP:116377856
6780+a, gdbSNP:146618142
6838+c, gdbSNP:56030607
6856+a, gdbSNP:78758928
7044+a, cdbSNP:77842807
7076+c, tdbSNP:183643327
7195+a, gdbSNP:186807468
7234+c, gdbSNP:4290648
7320+a, cdbSNP:115394347
7324+c, tdbSNP:191611754
7357+c, tdbSNP:114535536
7369+a, cdbSNP:7567291
7609+a, gdbSNP:149217054
7627+c, tdbSNP:4470338
7644+c, tdbSNP:184887995
7649+a, cdbSNP:190533664
7827+a, gdbSNP:57817160
7916+a, gdbSNP:113938533
7917+c, tdbSNP:59257065
8009..8011+, atadbSNP:137947510
Gene SymbolCOL4A3
Gene SynonymCOL4A3
Chromosome2
Locus Map2q36-q37
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000091 Homo sapiens collagen, type IV, alpha 3 (Goodpasture antigen) (COL4A3), mRNA. On-demand TBD TBD
Title High COL4A3 expression correlates with poor prognosis after cisplatin plus gemcitabine chemotherapy in non-small cell lung cancer .
Author Jiang,C.P., Wu,B.H., Chen,S.P., Fu,M.Y., Yang,M., Liu,F. and Wang,B.Q.
Journal Tumour Biol. 34 (1), 415-420 (2013)
Title Patients with Goodpasture's disease have two normal COL4A3 alleles encoding the NC1 domain of the type IV collagen alpha 3 chain .
Author Persson,U., Hertz,J.M., Carlsson,M., Hellmark,T., Juncker,I., Wieslander,J. and Segelmark,M.
Journal Nephrol. Dial. Transplant. 19 (8), 2030-2035 (2004)
Title Mutations in theCOL4A4 and COL4A3 genes cause familial benign hematuria .
Author Badenas,C., Praga,M., Tazon,B., Heidet,L., Arrondel,C., Armengol,A., Andres,A., Morales,E., Camacho,J.A., Lens,X., Davila,S., Mila,M., Antignac,C., Darnell,A. and Torra,R.
Journal J. Am. Soc. Nephrol. 13 (5), 1248-1254 (2002)
Title Characterization and expression of multiple alternatively spliced transcripts of the Goodpasture antigen gene region. Goodpasture antibodies recognize recombinant proteins representing the autoantigen and one of its alternative forms .
Author Penades,J.R., Bernal,D., Revert,F., Johansson,C., Fresquet,V.J., Cervera,J., Wieslander,J., Quinones,S. and Saus,J.
Journal Eur. J. Biochem. 229 (3), 754-760 (1995)
Title Mutations in the type IV collagen alpha 3 (COL4A3) gene in autosomal recessive Alport syndrome .
Author Lemmink,H.H., Mochizuki,T., van den Heuvel,L.P., Schroder,C.H., Barrientos,A., Monnens,L.A., van Oost,B.A., Brunner,H.G., Reeders,S.T. and Smeets,H.J.
Journal Hum. Mol. Genet. 3 (8), 1269-1273 (1994)
Title The alpha 3 chain of type IV collagen induces autoimmune Goodpasture syndrome .
Author Kalluri,R., Gattone,V.H. II, Noelken,M.E. and Hudson,B.G.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (13), 6201-6205 (1994)
Title Alternative splicing of the NC1 domain of the human alpha 3(IV) collagen gene. Differential expression of mRNA transcripts that predict three protein variants with distinct carboxyl regions .
Author Feng,L., Xia,Y. and Wilson,C.B.
Journal J. Biol. Chem. 269 (3), 2342-2348 (1994)
Title The human mRNA encoding the Goodpasture antigen is alternatively spliced .
Author Bernal,D., Quinones,S. and Saus,J.
Journal J. Biol. Chem. 268 (16), 12090-12094 (1993)
Title Short amino acid sequences derived from C1q receptor (C1q-R) show homology with the alpha chains of fibronectin and vitronectin receptors and collagen type IV .
Author Ghebrehiwet,B., Peerschke,E.I., Hong,Y., Munoz,P. and Gorevic,P.D.
Journal J. Leukoc. Biol. 51 (6), 546-556 (1992)
Title Molecular cloning of the human Goodpasture antigen demonstrates it to be the alpha 3 chain of type IV collagen .
Author Turner,N., Mason,P.J., Brown,R., Fox,M., Povey,S., Rees,A. and Pusey,C.D.
Journal J. Clin. Invest. 89 (2), 592-601 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.