• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens collagen, type IV, alpha 3 (Goodpasture antigen) (COL4A3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23179 Homo sapiens collagen, type IV, alpha 3 (Goodpasture antigen) (COL4A3), mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu23179C Homo sapiens collagen, type IV, alpha 3 (Goodpasture antigen) (COL4A3), mRNA. Customized vector On-demand TBD TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000091.4, 297632355
Length 5013 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens collagen, type IV, alpha 3 (Goodpasture antigen) (COL4A3), mRNA.
Product collagen alpha-3(IV) chain precursor
Comment

Summary: Type IV collagen, the major structural component of basement membranes, is a multimeric protein composed of 3 alpha subunits. These subunits are encoded by 6 different genes, alpha 1 through alpha 6, each of which can form a triple helix structure with 2 other subunits to form type IV collagen. This gene encodes alpha 3. In the Goodpasture syndrome, autoantibodies bind to the collagen molecules in the basement membranes of alveoli and glomeruli. The epitopes that elicit these autoantibodies are localized largely to the non-collagenous C-terminal domain of the protein. A specific kinase phosphorylates amino acids in this same C-terminal region and the expression of this kinase is upregulated during pathogenesis. This gene is also linked to an autosomal recessive form of Alport syndrome. The mutations contributing to this syndrome are also located within the exons that encode this C-terminal region. Like the other members of the type IV collagen gene family, this gene is organized in a head-to-head conformation with another type IV collagen gene so that each gene pair shares a common promoter. [provided by RefSeq, Jun 2010].

RefSeq NP_000082.2
CDS 163..5175
Misc Feature(1)112..114
Misc Feature(2)112..114
Misc Feature(3)247..288
Misc Feature(4)289..4476
Misc Feature(5)361..534
Misc Feature(6)451..627
Misc Feature(7)2533..2541
Misc Feature(8)2650..2817
Misc Feature(9)3148..3156
Misc Feature(10)3622..3630
Misc Feature(11)3652..3819
Misc Feature(12)4078..4086
Misc Feature(13)4195..4203
Misc Feature(14)4330..4476
Misc Feature(15)4438..4443
Misc Feature(16)4441..4494
Misc Feature(17)4456..4464
Misc Feature(18)4495..4824
Misc Feature(19)4597..4833
Misc Feature(20)4825..5163
Misc Feature(21)4990..5046
Exon (1)1..249
Gene:COL4A3
Gene Synonym:COL4A3
Exon (2)250..306
Gene:COL4A3
Gene Synonym:COL4A3
Exon (3)307..396
Gene:COL4A3
Gene Synonym:COL4A3
Exon (4)397..441
Gene:COL4A3
Gene Synonym:COL4A3
Exon (5)442..486
Gene:COL4A3
Gene Synonym:COL4A3
Exon (6)487..549
Gene:COL4A3
Gene Synonym:COL4A3
Exon (7)550..603
Gene:COL4A3
Gene Synonym:COL4A3
Exon (8)604..630
Gene:COL4A3
Gene Synonym:COL4A3
Exon (9)631..708
Gene:COL4A3
Gene Synonym:COL4A3
Exon (10)709..771
Gene:COL4A3
Gene Synonym:COL4A3
Exon (11)772..807
Gene:COL4A3
Gene Synonym:COL4A3
Exon (12)808..849
Gene:COL4A3
Gene Synonym:COL4A3
Exon (13)850..927
Gene:COL4A3
Gene Synonym:COL4A3
Exon (14)928..990
Gene:COL4A3
Gene Synonym:COL4A3
Exon (15)991..1050
Gene:COL4A3
Gene Synonym:COL4A3
Exon (16)1051..1095
Gene:COL4A3
Gene Synonym:COL4A3
Exon (17)1096..1149
Gene:COL4A3
Gene Synonym:COL4A3
Exon (18)1150..1191
Gene:COL4A3
Gene Synonym:COL4A3
Exon (19)1192..1276
Gene:COL4A3
Gene Synonym:COL4A3
Exon (20)1277..1312
Gene:COL4A3
Gene Synonym:COL4A3
Exon (21)1313..1477
Gene:COL4A3
Gene Synonym:COL4A3
Exon (22)1478..1570
Gene:COL4A3
Gene Synonym:COL4A3
Exon (23)1571..1666
Gene:COL4A3
Gene Synonym:COL4A3
Exon (24)1667..1737
Gene:COL4A3
Gene Synonym:COL4A3
Exon (25)1738..1920
Gene:COL4A3
Gene Synonym:COL4A3
Exon (26)1921..2089
Gene:COL4A3
Gene Synonym:COL4A3
Exon (27)2090..2182
Gene:COL4A3
Gene Synonym:COL4A3
Exon (28)2183..2287
Gene:COL4A3
Gene Synonym:COL4A3
Exon (29)2288..2385
Gene:COL4A3
Gene Synonym:COL4A3
Exon (30)2386..2536
Gene:COL4A3
Gene Synonym:COL4A3
Exon (31)2537..2650
Gene:COL4A3
Gene Synonym:COL4A3
Exon (32)2651..2818
Gene:COL4A3
Gene Synonym:COL4A3
Exon (33)2819..2908
Gene:COL4A3
Gene Synonym:COL4A3
Exon (34)2909..3043
Gene:COL4A3
Gene Synonym:COL4A3
Exon (35)3044..3142
Gene:COL4A3
Gene Synonym:COL4A3
Exon (36)3143..3232
Gene:COL4A3
Gene Synonym:COL4A3
Exon (37)3233..3372
Gene:COL4A3
Gene Synonym:COL4A3
Exon (38)3373..3499
Gene:COL4A3
Gene Synonym:COL4A3
Exon (39)3500..3580
Gene:COL4A3
Gene Synonym:COL4A3
Exon (40)3581..3679
Gene:COL4A3
Gene Synonym:COL4A3
Exon (41)3680..3727
Gene:COL4A3
Gene Synonym:COL4A3
Exon (42)3728..3913
Gene:COL4A3
Gene Synonym:COL4A3
Exon (43)3914..4044
Gene:COL4A3
Gene Synonym:COL4A3
Exon (44)4045..4117
Gene:COL4A3
Gene Synonym:COL4A3
Exon (45)4118..4189
Gene:COL4A3
Gene Synonym:COL4A3
Exon (46)4190..4315
Gene:COL4A3
Gene Synonym:COL4A3
Exon (47)4316..4414
Gene:COL4A3
Gene Synonym:COL4A3
Exon (48)4415..4624
Gene:COL4A3
Gene Synonym:COL4A3
Exon (49)4625..4802
Gene:COL4A3
Gene Synonym:COL4A3
Exon (50)4803..4917
Gene:COL4A3
Gene Synonym:COL4A3
Exon (51)4918..5090
Gene:COL4A3
Gene Synonym:COL4A3
Exon (52)5091..8097
Gene:COL4A3
Gene Synonym:COL4A3
Translation MSARTAPRPQVLLLPLLLVLLAAAPAASKGCVCKDKGQCFCDGAKGEKGEKGFPGPPGSP GQKGFTGPEGLPGPQGPKGFPGLPGLTGSKGVRGISGLPGFSGSPGLPGTPGNTGPYGLV GVPGCSGSKGEQGFPGLPGTLGYPGIPGAAGLKGQKGAPAKEEDIELDAKGDPGLPGAPG PQGLPGPPGFPGPVGPPGPPGFFGFPGAMGPRGPKGHMGERVIGHKGERGVKGLTGPPGP PGTVIVTLTGPDNRTDLKGEKGDKGAMGEPGPPGPSGLPGESYGSEKGAPGDPGLQGKPG KDGVPGFPGSEGVKGNRGFPGLMGEDGIKGQKGDIGPPGFRGPTEYYDTYQEKGDEGTPG PPGPRGARGPQGPSGPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSP GCAGSPGLPGSPGPPGPPGDIVFRKGPPGDHGLPGYLGSPGIPGVDGPKGEPGLLCTQCP YIPGPPGLPGLPGLHGVKGIPGRQGAAGLKGSPGSPGNTGLPGFPGFPGAQGDPGLKGEK GETLQPEGQVGVPGDPGLRGQPGRKGLDGIPGTPGVKGLPGPKGELALSGEKGDQGPPGD PGSPGSPGPAGPAGPPGYGPQGEPGLQGTQGVPGAPGPPGEAGPRGELSVSTPVPGPPGP PGPPGHPGPQGPPGIPGSLGKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGTKGSL GCPGKMGEPGLPGKPGLPGAKGEPAVAMPGGPGTPGFPGERGNSGEHGEIGLPGLPGLPG TPGNEGLDGPRGDPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGD PGIPGLDRSGFPGETGSPGIPGHQGEMGPLGQRGYPGNPGILGPPGEDGVIGMMGFPGAI GPPGPPGNPGTPGQRGSPGIPGVKGQRGTPGAKGEQGDKGNPGPSEISHVIGDKGEPGLK GFAGNPGEKGNRGVPGMPGLKGLKGLPGPAGPPGPRGDLGSTGNPGEPGLRGIPGSMGNM GMPGSKGKRGTLGFPGRAGRPGLPGIHGLQGDKGEPGYSEGTRPGPPGPTGDPGLPGDMG KKGEMGQPGPPGHLGPAGPEGAPGSPGSPGLPGKPGPHGDLGFKGIKGLLGPPGIRGPPG LPGFPGSPGPMGIRGDQGRDGIPGPAGEKGETGLLRAPPGPRGNPGAQGAKGDRGAPGFP GLPGRKGAMGDAGPRGPTGIEGFPGPPGLPGAIIPGQTGNRGPPGSRGSPGAPGPPGPPG SHVIGIKGDKGSMGHPGPKGPPGTAGDMGPPGRLGAPGTPGLPGPRGDPGFQGFPGVKGE KGNPGFLGSIGPPGPIGPKGPPGVRGDPGTLKIISLPGSPGPPGTPGEPGMQGEPGPPGP PGNLGPCGPRGKPGKDGKPGTPGPAGEKGNKGSKGEPGPAGSDGLPGLKGKRGDSGSPAT WTTRGFVFTRHSQTTAIPSCPEGTVPLYSGFSFLFVQGNQRAHGQDLGTLGSCLQRFTTM PFLFCNVNDVCNFASRNDYSYWLSTPALMPMNMAPITGRALEPYISRCTVCEGPAIAIAV HSQTTDIPPCPHGWISLWKGFSFIMFTSAGSEGTGQALASPGSCLEEFRASPFLECHGRG TCNYYSNSYSFWLASLNPERMFRKPIPSTVKAGELEKIISRCQVCMKKRH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
233+c, gdbSNP:184704920
235+c, tdbSNP:139271412
274+dbSNP:
274+c, gdbSNP:201607115
288+c, tdbSNP:369251968
289+c, gdbSNP:13424243
298+a, gdbSNP:200866082
302+a, gdbSNP:370204395
333+dbSNP:
333+c, tdbSNP:368291735
334+a, gdbSNP:184730597
366+c, tdbSNP:200170381
383+c, tdbSNP:373975901
384+a, g, tdbSNP:187950806
395+a, gdbSNP:13405977
409+dbSNP:
409+c, gdbSNP:372621387
422+c, tdbSNP:377136253
423+c, gdbSNP:369517619
436+c, gdbSNP:200873401
445+dbSNP:
445+a, cdbSNP:201222896
466+c, tdbSNP:375028468
477+c, tdbSNP:371460434
486+a, tdbSNP:186323744
505+dbSNP:
505+a, gdbSNP:202147112
508+a, cdbSNP:115324397
556+dbSNP:
556+c, tdbSNP:372041612
561+a, gdbSNP:75683214
584+c, tdbSNP:10178458
603+a, gdbSNP:373559251
643+dbSNP:
643+a, gdbSNP:369945847
647+a, gdbSNP:6436669
656+c, tdbSNP:144036466
659+a, gdbSNP:369769279
675+c, tdbSNP:199514043
676+a, gdbSNP:377575924
694+a, gdbSNP:188324379
730+dbSNP:
730+c, tdbSNP:371173786
735+c, tdbSNP:375503109
761+c, tdbSNP:368480491
762+a, gdbSNP:371948448
771+c, tdbSNP:375465831
834+dbSNP:
834+a, gdbSNP:375059614
837+g, tdbSNP:367635426
848+a, gdbSNP:188942711
861+dbSNP:
861+g, tdbSNP:372481879
879+a, gdbSNP:377503376
903+c, gdbSNP:199887536
955+dbSNP:
955+a, gdbSNP:374787000
967+a, gdbSNP:80109666
986+c, tdbSNP:372626966
1032+dbSNP:
1032+c, tdbSNP:373130348
1059+dbSNP:
1059+c, tdbSNP:368027756
1138+dbSNP:
1138+g, tdbSNP:55703767
1155+dbSNP:
1155+c, gdbSNP:369701669
1184+a, gdbSNP:200738124
1211+dbSNP:
1211+a, gdbSNP:201909310
1274+a, gdbSNP:199543633
1357+dbSNP:
1357+c, tdbSNP:10205042
1378+a, cdbSNP:371334239
1379+a, gdbSNP:373952897
1385+a, gdbSNP:34505188
1411+c, tdbSNP:373390728
1418+a, cdbSNP:201031986
1472+c, tdbSNP:148686474
1473+a, gdbSNP:369557944
1485+dbSNP:
1485+a, cdbSNP:73080086
1514+a, gdbSNP:11677877
1515+c, tdbSNP:189364374
1523+a, cdbSNP:374905404
1524+a, tdbSNP:377373374
1541+c, tdbSNP:371585017
1560+c, tdbSNP:145833114
1561+c, gdbSNP:201088233
1614+dbSNP:
1614+a, gdbSNP:34019152
1619+c, tdbSNP:372903565
1645+c, tdbSNP:200510532
1656+a, cdbSNP:200207635
1677+dbSNP:
1677+c, tdbSNP:200416402
1678+a, gdbSNP:188967260
1745+dbSNP:
1745+c, tdbSNP:367868483
1757+a, gdbSNP:371405814
1827+c, gdbSNP:375766511
1883+c, tdbSNP:28381984
1936+dbSNP:
1936+a, cdbSNP:377125283
1964+c, tdbSNP:369567469
2022+c, tdbSNP:376896231
2048+c, tdbSNP:139361545
2049+a, g, tdbSNP:201109911
2079+c, tdbSNP:369320502
2080+a, gdbSNP:200672668
2106+dbSNP:
2106+c, tdbSNP:199554662
2125+c, tdbSNP:370768231
2208+dbSNP:
2208+c, tdbSNP:367628136
2245+a, gdbSNP:200287952
2272+c, tdbSNP:376083145
2277+a, tdbSNP:201419174
2281+c, tdbSNP:368429205
2315+dbSNP:
2315+a, gdbSNP:267599232
2325+c, tdbSNP:369342543
2330+c, tdbSNP:201198284
2336+a, gdbSNP:199734116
2377+a, gdbSNP:375040636
2441+dbSNP:
2441+a, tdbSNP:368940964
2538+dbSNP:
2538+a, cdbSNP:373177798
2553+c, tdbSNP:187921460
2610+c, tdbSNP:370583118
2612+a, gdbSNP:374735941
2637+c, gdbSNP:192027050
2663+dbSNP:
2663+a, gdbSNP:56226424
2666+c, tdbSNP:374379775
2678+a, gdbSNP:267599233
2798+c, tdbSNP:368342782
2824+dbSNP:
2824+a, gdbSNP:376762135
2861+c, tdbSNP:201665434
2877+a, gdbSNP:386438118
2877+c, tdbSNP:75519005
2962+dbSNP:
2962+a, gdbSNP:199956740
2975+a, gdbSNP:202161876
2988+c, tdbSNP:201064766
3009+c, tdbSNP:373842619
3010+a, gdbSNP:200044988
3048+dbSNP:
3048+c, tdbSNP:77846212
3049+a, gdbSNP:200801946
3107+a, gdbSNP:371185804
3116+g, tdbSNP:121912827
3123+c, tdbSNP:375523118
3157+dbSNP:
3157+c, tdbSNP:371574290
3193+c, tdbSNP:73996408
3206+a, gdbSNP:121912826
3212+c, tdbSNP:367691204
3221+c, tdbSNP:202071907
3256+dbSNP:
3256+c, tdbSNP:372423505
3262+a, tdbSNP:376750724
3281+c, gdbSNP:187864249
3344+a, gdbSNP:202078295
3345+c, tdbSNP:373695524
3358+c, tdbSNP:377003650
3362+c, gdbSNP:55849096
3363+a, gdbSNP:191829138
3371+a, cdbSNP:373628122
3389+dbSNP:
3389+c, tdbSNP:200984988
3390+a, gdbSNP:200125890
3417+a, gdbSNP:374427586
3420+a, gdbSNP:147085074
3432+a, cdbSNP:201989155
3466+a, gdbSNP:368275495
3487+c, tdbSNP:55816283
3488+c, gdbSNP:373982111
3497+c, tdbSNP:367929808
3525+dbSNP:
3525+a, gdbSNP:372694554
3597+dbSNP:
3597+a, tdbSNP:191363114
3602+c, tdbSNP:200107989
3637+a, cdbSNP:142376694
3638+a, gdbSNP:145948549
3661+a, gdbSNP:267606745
3677+c, tdbSNP:373950389
3714+dbSNP:
3714+a, cdbSNP:374145134
3769+dbSNP:
3769+c, tdbSNP:200884685
3789+a, gdbSNP:200562865
3794+a, gdbSNP:376091129
3805+c, tdbSNP:368434069
3806+a, gdbSNP:200443942
3852+c, tdbSNP:375442737
3863+a, tdbSNP:55825399
3883+c, tdbSNP:369551948
3884+a, gdbSNP:201841428
3909+c, tdbSNP:371962784
3918+dbSNP:
3918+a, g, tdbSNP:112516617
3969+a, cdbSNP:57611801
3978+c, tdbSNP:376887131
3987+c, tdbSNP:143380907
3991+a, gdbSNP:190598500
4024+a, cdbSNP:202085686
4040+a, gdbSNP:201095498
4065+dbSNP:
4065+a, tdbSNP:377082797
4079+a, gdbSNP:57311286
4101+a, gdbSNP:141552752
4107+a, gdbSNP:189574905
4110+a, cdbSNP:368594549
4111+a, gdbSNP:200017859
4123+dbSNP:
4123+a, gdbSNP:375278276
4135+a, gdbSNP:368351146
4139+c, tdbSNP:201056180
4145+g, tdbSNP:372237167
4163+a, gdbSNP:375290088
4195+dbSNP:
4195+c, tdbSNP:369088928
4203+a, cdbSNP:73996414
4218+a, gdbSNP:373251831
4221+a, tdbSNP:374672854
4340+dbSNP:
4340+c, tdbSNP:370516752
4366+a, cdbSNP:199548916
4400+c, tdbSNP:373382431
4431+dbSNP:
4431+c, tdbSNP:372923451
4439+a, cdbSNP:375858137
4457+a, gdbSNP:200509072
4458+g, tdbSNP:377652781
4524+a, cdbSNP:373176486
4527+a, gdbSNP:377008307
4542+c, tdbSNP:114430490
4560+a, cdbSNP:184847026
4569+c, tdbSNP:373720128
4583+c, tdbSNP:200302125
4603+c, tdbSNP:121912824
4607+c, tdbSNP:199755408
4611+c, tdbSNP:140672401
4628+dbSNP:
4628+c, tdbSNP:200818438
4634+a, gdbSNP:374353882
4644+a, gdbSNP:181952966
4646+a, gdbSNP:77964815
4656+c, gdbSNP:200454769
4672+c, tdbSNP:201671013
4676+g, tdbSNP:74333012
4685+a, gdbSNP:200512461
4709+a, gdbSNP:368726092
4733+c, gdbSNP:121912825
4803+dbSNP:
4803+a, gdbSNP:377150513
4811+g, tdbSNP:200655479
4826+c, tdbSNP:369575989
4827+a, g, tdbSNP:200858199
4862+g, tdbSNP:371452712
4865+c, tdbSNP:267599234
4869+a, tdbSNP:113401495
4938+dbSNP:
4938+c, gdbSNP:370000381
4940+g, tdbSNP:373407763
5013+g, tdbSNP:74379096
5055+c, tdbSNP:183218622
5137+dbSNP:
5137+a, gdbSNP:193076251
complement(5138)-t, cdbSNP:75042602
5143+c, tdbSNP:201697532
5144+a, gdbSNP:374158562
5156+a, gdbSNP:376550779
5234+a, gdbSNP:370641364
5283+c, gdbSNP:200803393
complement(5352)-g, adbSNP:139638980
5461+c, tdbSNP:6436677
5463+g, tdbSNP:376763557
5490+a, cdbSNP:2070735
5510+a, gdbSNP:115158745
5614+a, gdbSNP:374241146
5727+c, gdbSNP:112338364
5764+c, tdbSNP:55698424
5770+a, tdbSNP:56123646
5822+g, tdbSNP:183552783
5986+a, cdbSNP:116568659
6030+c, tdbSNP:373883262
6033+a, cdbSNP:376204548
6068+a, gdbSNP:386611698
6068+c, tdbSNP:7587228
6144+a, gdbSNP:188150740
6147+a, cdbSNP:372910422
6156+c, tdbSNP:1134745
6202+a, cdbSNP:377487079
6231..6232+, adbSNP:367667701
6232+, adbSNP:11297279
6245..6246+, aadbSNP:59670450
6340+a, gdbSNP:28554165
6414+c, gdbSNP:10188531
6449+c, tdbSNP:192736312
6497+a, tdbSNP:115338903
6497+a, tdbSNP:386465935
6535+a, tdbSNP:116377856
6769+c, tdbSNP:375140456
6780+a, gdbSNP:146618142
6809+c, gdbSNP:376587950
6838+c, gdbSNP:56030607
6856+a, gdbSNP:78758928
7044+a, cdbSNP:77842807
7076+c, tdbSNP:183643327
7195+a, gdbSNP:186807468
7234+c, gdbSNP:4290648
7320+a, cdbSNP:115394347
7324+c, tdbSNP:191611754
7357+c, tdbSNP:114535536
7369+a, cdbSNP:7567291
7403+c, tdbSNP:367785196
7415+c, tdbSNP:374553916
7609+a, gdbSNP:149217054
7627+c, tdbSNP:4470338
7644+c, tdbSNP:184887995
7649+a, cdbSNP:190533664
7827+a, gdbSNP:57817160
7916+a, gdbSNP:113938533
7917+c, tdbSNP:59257065
8009..8011+, atadbSNP:137947510
Gene SymbolCOL4A3
Gene SynonymCOL4A3
Chromosome2
Locus Map2q36-q37
Title Evidence for activation of the unfolded protein response in collagen IV nephropathies .
Author Pieri M, Stefanou C, Zaravinos A, Erguler K, Stylianou K, Lapathitis G, Karaiskos C, Savva I, Paraskeva R, Dweep H, Sticht C, Anastasiadou N, Zouvani I, Goumenos D, Felekkis K, Saleem M, Voskarides K, Gretz N and Deltas C.
Journal J. Am. Soc. Nephrol. 25 (2), 260-275 (2014)
Title Patients with Goodpasture's disease have two normal COL4A3 alleles encoding the NC1 domain of the type IV collagen alpha 3 chain .
Author Persson U, Hertz JM, Carlsson M, Hellmark T, Juncker I, Wieslander
Journal Nephrol. Dial. Transplant. 19 (8), 2030-2035 (2004)
Title Mutations in theCOL4A4 and COL4A3 genes cause familial benign hematuria .
Author Badenas C, Praga M, Tazon B, Heidet L, Arrondel C, Armengol A, Andres A, Morales E, Camacho JA, Lens X, Davila S, Mila M, Antignac C, Darnell A and Torra R.
Journal J. Am. Soc. Nephrol. 13 (5), 1248-1254 (2002)
Title Characterization and expression of multiple alternatively spliced transcripts of the Goodpasture antigen gene region. Goodpasture antibodies recognize recombinant proteins representing the autoantigen and one of its alternative forms .
Author Penades JR, Bernal D, Revert F, Johansson C, Fresquet VJ, Cervera J, Wieslander J, Quinones S and Saus J.
Journal Eur. J. Biochem. 229 (3), 754-760 (1995)
Title Mutations in the type IV collagen alpha 3 (COL4A3) gene in autosomal recessive Alport syndrome .
Author Lemmink HH, Mochizuki T, van den Heuvel LP, Schroder CH, Barrientos A, Monnens LA, van Oost BA, Brunner HG, Reeders ST and Smeets HJ.
Journal Hum. Mol. Genet. 3 (8), 1269-1273 (1994)
Title The alpha 3 chain of type IV collagen induces autoimmune Goodpasture syndrome .
Author Kalluri R, Gattone VH 2nd, Noelken ME and Hudson BG.
Journal Proc. Natl. Acad. Sci. U.S.A. 91 (13), 6201-6205 (1994)
Title Alternative splicing of the NC1 domain of the human alpha 3(IV) collagen gene. Differential expression of mRNA transcripts that predict three protein variants with distinct carboxyl regions .
Author Feng L, Xia Y and Wilson CB.
Journal J. Biol. Chem. 269 (3), 2342-2348 (1994)
Title The human mRNA encoding the Goodpasture antigen is alternatively spliced .
Author Bernal D, Quinones S and Saus J.
Journal J. Biol. Chem. 268 (16), 12090-12094 (1993)
Title Alport Syndrome and Thin Basement Membrane Nephropathy .
Author Kashtan,C.E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Molecular cloning of the human Goodpasture antigen demonstrates it to be the alpha 3 chain of type IV collagen .
Author Turner N, Mason PJ, Brown R, Fox M, Povey S, Rees A and Pusey CD.
Journal J. Clin. Invest. 89 (2), 592-601 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.