• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cartilage oligomeric matrix protein (COMP), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19189 Homo sapiens cartilage oligomeric matrix protein (COMP), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19189C Homo sapiens cartilage oligomeric matrix protein (COMP), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000095.2, 40217842
Length 2274 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens cartilage oligomeric matrix protein (COMP), mRNA.
Product cartilage oligomeric matrix protein precursor
Comment

Summary: The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Mutations can cause the osteochondrodysplasias pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED). [provided by RefSeq, Jul 2008].

RefSeq NP_000086.2
CDS 37..2310
Misc Feature(1)100..294
Misc Feature(2)121..255
Misc Feature(3)415..522
Misc Feature(4)order(415..417,424..426,466..468)
Misc Feature(5)574..684
Misc Feature(6)order(574..576,583..585,631..633)
Misc Feature(7)838..936
Misc Feature(8)937..1044
Misc Feature(9)940..1044
Misc Feature(10)1045..1113
Misc Feature(11)1114..1221
Misc Feature(12)1135..1143
Misc Feature(13)1222..1290
Misc Feature(14)1225..1404
Misc Feature(15)1291..1404
Misc Feature(16)1405..1512
Misc Feature(17)1513..1620
Misc Feature(18)1516..1620
Misc Feature(19)1615..2307
Misc Feature(20)1672..2274
Exon (1)1..115
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (2)116..201
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (3)202..253
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (4)254..426
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (5)427..564
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (6)565..639
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (7)640..798
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (8)799..903
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (9)904..1011
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (10)1012..1171
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (11)1172..1290
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (12)1291..1343
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (13)1344..1525
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (14)1526..1704
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (15)1705..1753
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (16)1754..1950
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (17)1951..2123
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (18)2124..2263
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (19)2264..2452
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Translation MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTD INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEH ADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQK DTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDS RDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDT ESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(22)-dbSNP:
complement(22)-g, adbSNP:374273743
complement(28)-c, adbSNP:186562511
complement(29)-t, gdbSNP:377427968
complement(34)-c, adbSNP:372647850
complement(47)-t, gdbSNP:370458957
complement(152)-dbSNP:
complement(152)-t, adbSNP:369162037
complement(168)-t, cdbSNP:377650362
complement(172)-g, adbSNP:374010493
complement(235)-dbSNP:
complement(235)-t, cdbSNP:142742836
complement(237)-t, g, cdbSNP:199553971
complement(315)-dbSNP:
complement(315)-t, gdbSNP:139319996
complement(396)-g, adbSNP:150820366
complement(399)-g, adbSNP:372321928
complement(418)-t, cdbSNP:143954978
complement(432)-dbSNP:
complement(432)-g, cdbSNP:200638121
complement(489)-g, adbSNP:201389713
complement(504)-c, adbSNP:202241721
complement(547)-t, cdbSNP:115338183
complement(602)-dbSNP:
complement(602)-t, cdbSNP:199792797
complement(624)-t, cdbSNP:201165293
complement(702)-dbSNP:
complement(702)-t, cdbSNP:55948627
complement(722)-t, cdbSNP:201319844
complement(729)-t, gdbSNP:374210489
complement(742)-c, adbSNP:369872519
complement(804)-dbSNP:
complement(804)-g, cdbSNP:369897902
complement(856)-t, cdbSNP:374743161
complement(861)-t, gdbSNP:138296278
complement(886)-t, cdbSNP:145895692
complement(937)-dbSNP:
complement(937)-g, cdbSNP:377504596
complement(956)-t, cdbSNP:375332869
complement(960)-g, adbSNP:199596155
complement(977)-g, adbSNP:370913967
complement(984)-g, adbSNP:377675152
complement(987)-t, g, adbSNP:200547692
complement(1004)-t, cdbSNP:367812050
1018+dbSNP:
1018+c, tdbSNP:137852653
complement(1050)-g, adbSNP:188279224
1060+g, tdbSNP:137852652
1078+c, tdbSNP:137852656
complement(1080)-t, gdbSNP:199732560
complement(1090)-g, adbSNP:142274526
complement(1095)-g, adbSNP:138804934
1177+dbSNP:
1177+c, tdbSNP:3179763
complement(1178)-t, cdbSNP:144953891
1192..1194+, aacdbSNP:397515510
complement(1192)-t, cdbSNP:61739916
complement(1204)-t, cdbSNP:151050419
complement(1234)-t, cdbSNP:200422116
complement(1236)-g, adbSNP:201063220
complement(1284)-t, cdbSNP:368715216
complement(1290)-c, adbSNP:375908187
complement(1353)-g, adbSNP:368273443
1394+a, gdbSNP:28936668
complement(1420)-t, cdbSNP:375476152
1439+a, gdbSNP:137852651
complement(1440)-t, gdbSNP:375031149
1447+g, tdbSNP:28933699
1450+g, tdbSNP:137852650
1453..1455+, gacdbSNP:312262897
1454+a, gdbSNP:28936669
1455..1456+, gacdbSNP:312262898
complement(1489)-g, cdbSNP:191645921
complement(1520)-t, gdbSNP:373687591
complement(1524)-t, gdbSNP:143714206
complement(1527)-dbSNP:
complement(1527)-t, cdbSNP:200037349
complement(1554)-g, adbSNP:149083265
1605+c, gdbSNP:137852654
1615+a, gdbSNP:312262902
1622+c, tdbSNP:312262903
complement(1624)-t, cdbSNP:145034923
complement(1640)-t, cdbSNP:145283906
complement(1643)-g, adbSNP:377451339
complement(1670)-g, adbSNP:200870935
complement(1686)-g, cdbSNP:373498615
1701+a, cdbSNP:397515511
complement(1727)-g, adbSNP:376678596
complement(1770)-dbSNP:
complement(1770)-g, adbSNP:61741109
1783+a, gdbSNP:312262899
1790+a, c, g, tdbSNP:312262900
complement(1791)-t, cdbSNP:34467947
1796+a, gdbSNP:312262901
1849+a, gdbSNP:397515512
complement(1866)-g, adbSNP:147854039
complement(1887)-t, cdbSNP:367665774
complement(1896)-t, cdbSNP:376703016
complement(1906..1907)-, cccccdbSNP:140413656
complement(1907)-g, cdbSNP:201624503
complement(1908)-t, cdbSNP:200802161
complement(1930)-t, cdbSNP:144170209
complement(1934)-g, adbSNP:202228058
1957+dbSNP:
1957+c, tdbSNP:75729528
complement(1974)-g, adbSNP:368459775
complement(1981)-g, cdbSNP:375484943
complement(1983)-t, cdbSNP:371148267
complement(1989..1990)-, cdbSNP:35029628
complement(1992)-g, adbSNP:10421797
complement(1998)-t, cdbSNP:368444727
complement(2007)-t, cdbSNP:201439283
complement(2014)-t, cdbSNP:376437040
complement(2015)-g, cdbSNP:150534218
complement(2017)-t, cdbSNP:372414886
complement(2024)-t, adbSNP:141708238
complement(2029)-g, adbSNP:370202476
complement(2050)-g, adbSNP:148554460
2078+c, gdbSNP:397515513
complement(2117)-t, gdbSNP:146374758
complement(2157)-dbSNP:
complement(2157)-g, adbSNP:142160846
complement(2169)-t, cdbSNP:139001378
complement(2188)-t, cdbSNP:386576630
complement(2189)-t, g, cdbSNP:149551600
2191+a, gdbSNP:312262904
2192+a, gdbSNP:137852655
complement(2206)-t, cdbSNP:372951104
complement(2215)-g, adbSNP:374459827
complement(2255)-t, cdbSNP:138174876
complement(2288)-dbSNP:
complement(2288)-g, cdbSNP:201049035
complement(2294)-t, adbSNP:201893904
complement(2298)-t, cdbSNP:150428337
complement(2299)-g, adbSNP:140511415
complement(2303)-t, cdbSNP:61752496
complement(2311)-g, cdbSNP:77185131
complement(2317)-c, adbSNP:191758256
complement(2325)-t, cdbSNP:201937857
complement(2329)-t, cdbSNP:376290752
complement(2350)-g, adbSNP:374714490
complement(2352)-t, cdbSNP:370642118
complement(2394)-t, cdbSNP:186977122
2402+a, gdbSNP:9407
Gene SymbolCOMP
Gene SynonymEDM1; EPD1; MED; PSACH; THBS5
Chromosome19
Locus Map19p13.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000095 Homo sapiens cartilage oligomeric matrix protein (COMP), mRNA. In-stock $99.00 5-7
Title [Clinical features and COMP gene mutation in a family with a pseudoachondroplasia child] .
Author Lu CT, Guo L, Zahng ZH, Lin WX, Song YZ and Feng L.
Journal Zhongguo Dang Dai Er Ke Za Zhi 15 (11), 937-941 (2013)
Title Cartilage oligomeric matrix protein enhances osteogenesis by directly binding and activating bone morphogenetic protein-2 .
Author Ishida K, Acharya C, Christiansen BA, Yik JH, DiCesare PE and Haudenschild DR.
Journal Bone 55 (1), 23-35 (2013)
Title A novel COMP mutation in a Chinese patient with pseudoachondroplasia .
Author Xie X, Liao L, Gao J and Luo X.
Journal Gene 522 (1), 102-106 (2013)
Title Early increase in serum-COMP is associated with joint damage progression over the first five years in patients with rheumatoid arthritis .
Author Andersson ML, Svensson B, Petersson IF, Hafstrom I, Albertsson K, Forslind K, Heinegard D and Saxne T.
Journal BMC Musculoskelet Disord 14, 229 (2013)
Title Pseudoachondroplasia and multiple epiphyseal dysplasia due to mutations in the cartilage oligomeric matrix protein gene .
Author Briggs MD, Hoffman SM, King LM, Olsen AS, Mohrenweiser H, Leroy JG, Mortier GR, Rimoin DL, Lachman RS and Gaines ES.
Journal Nat. Genet. 10 (3), 330-336 (1995)
Title Mutations in exon 17B of cartilage oligomeric matrix protein (COMP) cause pseudoachondroplasia .
Author Hecht JT, Nelson LD, Crowder E, Wang Y, Elder FF, Harrison WR, Francomano CA, Prange CK, Lennon GG and Deere M.
Journal Nat. Genet. 10 (3), 325-329 (1995)
Title Cartilage and bone metabolism in rheumatoid arthritis. Differences between rapid and slow progression of disease identified by serum markers of cartilage metabolism .
Author Mansson B, Carey D, Alini M, Ionescu M, Rosenberg LC, Poole AR, Heinegard D and Saxne T.
Journal J. Clin. Invest. 95 (3), 1071-1077 (1995)
Title Characterization of human and mouse cartilage oligomeric matrix protein .
Author Newton G, Weremowicz S, Morton CC, Copeland NG, Gilbert DJ, Jenkins
Journal Genomics 24 (3), 435-439 (1994)
Title Pseudoachondroplasia .
Author Briggs,M.D. and Wright,M.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Multiple Epiphyseal Dysplasia, Dominant .
Author Briggs,M.D., Wright,M.J. and Mortier,G.R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.