• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cartilage oligomeric matrix protein (COMP), mRNA.


RefSeq Accession Definition Services Price Order
NM_000095 Homo sapiens cartilage oligomeric matrix protein (COMP), mRNA. ORF Sequence $659.46
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000095.2, 40217842
Length 2471 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cartilage oligomeric matrix protein (COMP), mRNA.
Product cartilage oligomeric matrix protein precursor
Comment

Summary: The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Mutations can cause the osteochondrodysplasias pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED). [provided by RefSeq, Jul 2008].

RefSeq NP_000086.2
CDS 37..2310
Misc Feature(1)100..294
Misc Feature(2)121..255
Misc Feature(3)415..522
Misc Feature(4)order(415..417,424..426,466..468)
Misc Feature(5)574..684
Misc Feature(6)order(574..576,583..585,631..633)
Misc Feature(7)838..936
Misc Feature(8)937..1044
Misc Feature(9)1045..1113
Misc Feature(10)1114..1221
Misc Feature(11)1135..1143
Misc Feature(12)1222..1290
Misc Feature(13)1291..1404
Misc Feature(14)1405..1512
Misc Feature(15)1513..1620
Misc Feature(16)1516..1620
Misc Feature(17)1615..2307
Misc Feature(18)1672..2274
Exon (1)1..115
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (2)116..201
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (3)202..253
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (4)254..426
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (5)427..564
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (6)565..639
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (7)640..798
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (8)799..903
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (9)904..1011
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (10)1012..1171
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (11)1172..1290
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (12)1291..1343
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (13)1344..1525
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (14)1526..1704
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (15)1705..1753
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (16)1754..1950
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (17)1951..2123
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (18)2124..2263
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Exon (19)2264..2452
Gene:COMP
Gene Synonym:EDM1; EPD1; MED; PSACH; THBS5
Translation MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTD INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEH ADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQK DTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDS RDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDT ESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(28)-dbSNP:
complement(28)-c, adbSNP:186562511
complement(235)-dbSNP:
complement(235)-t, cdbSNP:142742836
complement(237)-g, cdbSNP:199553971
complement(315)-dbSNP:
complement(315)-t, gdbSNP:139319996
complement(396)-g, adbSNP:150820366
complement(418)-t, cdbSNP:143954978
complement(432)-dbSNP:
complement(432)-g, cdbSNP:200638121
complement(489)-g, adbSNP:201389713
complement(504)-c, adbSNP:202241721
complement(547)-t, cdbSNP:115338183
complement(602)-dbSNP:
complement(602)-t, cdbSNP:199792797
complement(624)-t, cdbSNP:201165293
complement(702)-dbSNP:
complement(702)-t, cdbSNP:55948627
complement(722)-t, cdbSNP:201319844
complement(861)-dbSNP:
complement(861)-t, gdbSNP:138296278
complement(886)-t, cdbSNP:145895692
complement(960)-dbSNP:
complement(960)-g, adbSNP:199596155
complement(987)-t, gdbSNP:200547692
complement(1018)-dbSNP:
complement(1018)-t, cdbSNP:137852653
complement(1050)-g, adbSNP:188279224
complement(1060)-t, gdbSNP:137852652
complement(1078)-t, cdbSNP:137852656
complement(1080)-t, gdbSNP:199732560
complement(1090)-g, adbSNP:142274526
complement(1095)-g, adbSNP:138804934
complement(1177)-dbSNP:
complement(1177)-t, cdbSNP:3179763
complement(1178)-t, cdbSNP:144953891
complement(1192)-t, cdbSNP:61739916
complement(1204)-t, cdbSNP:151050419
complement(1234)-t, cdbSNP:200422116
complement(1236)-g, adbSNP:201063220
complement(1394)-g, adbSNP:28936668
complement(1439)-g, adbSNP:137852651
complement(1447)-t, gdbSNP:28933699
complement(1450)-t, gdbSNP:137852650
1453..1455+, gacdbSNP:312262897
complement(1454)-g, adbSNP:28936669
1455..1456+, gacdbSNP:312262898
complement(1489)-g, cdbSNP:191645921
complement(1524)-t, gdbSNP:143714206
complement(1527)-dbSNP:
complement(1527)-t, cdbSNP:200037349
complement(1554)-g, adbSNP:149083265
complement(1605)-g, cdbSNP:137852654
1615+a, gdbSNP:312262902
1622+c, tdbSNP:312262903
complement(1624)-t, cdbSNP:145034923
complement(1640)-t, cdbSNP:145283906
complement(1670)-g, adbSNP:200870935
complement(1770)-dbSNP:
complement(1770)-g, adbSNP:61741109
1783+a, gdbSNP:312262899
1790+a, c, g, tdbSNP:312262900
complement(1791)-t, cdbSNP:34467947
1796+a, gdbSNP:312262901
complement(1866)-g, adbSNP:147854039
complement(1907..1908)-, cccccdbSNP:140413656
complement(1907)-g, cdbSNP:201624503
complement(1908)-t, cdbSNP:200802161
complement(1930)-t, cdbSNP:144170209
complement(1934)-g, adbSNP:202228058
complement(1957)-dbSNP:
complement(1957)-t, cdbSNP:75729528
complement(1989..1990)-, cdbSNP:35029628
complement(1992)-g, adbSNP:10421797
complement(2007)-t, cdbSNP:201439283
complement(2015)-g, cdbSNP:150534218
complement(2024)-t, adbSNP:141708238
complement(2050)-g, adbSNP:148554460
complement(2117)-t, gdbSNP:146374758
complement(2135..2136)-dbSNP:
complement(2135..2136)-, atdbSNP:71769201
complement(2157)-g, adbSNP:142160846
complement(2169)-t, cdbSNP:139001378
complement(2188)-t, c, adbSNP:28936368
complement(2189)-t, cdbSNP:149551600
2191+a, gdbSNP:312262904
2192+a, gdbSNP:137852655
complement(2255)-t, cdbSNP:138174876
complement(2288)-dbSNP:
complement(2288)-g, cdbSNP:201049035
complement(2294)-t, adbSNP:201893904
complement(2298)-t, cdbSNP:150428337
complement(2299)-g, adbSNP:140511415
complement(2303)-t, cdbSNP:61752496
complement(2311)-g, cdbSNP:77185131
complement(2317)-c, adbSNP:191758256
complement(2325)-t, cdbSNP:201937857
complement(2394)-t, cdbSNP:186977122
complement(2402)-g, adbSNP:9407
Gene SymbolCOMP
Gene SynonymEDM1; EPD1; MED; PSACH; THBS5
Chromosome19
Locus Map19p13.1
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000095 Homo sapiens cartilage oligomeric matrix protein (COMP), mRNA. Full Length $716.59
ORF Sequence $659.46
Title Identification of a 3Kbp mechanoresponsive promoter region in the human cartilage oligomeric matrix protein gene .
Author Amanatullah,D.F., Lu,J., Hecht,J., Posey,K., Yik,J., Di Cesare,P.E. and Haudenschild,D.R.
Journal Tissue Eng Part A 18 (17-18), 1882-1889 (2012)
Title Relations of serum COMP to cardiovascular risk factors and endothelial function in patients with rheumatoid arthritis treated with methotrexate and TNF-alpha inhibitors .
Author Hjeltnes,G., Hollan,I., Forre,O., Wiik,A., Lyberg,T., Mikkelsen,K. and Agewall,S.
Journal J. Rheumatol. 39 (7), 1341-1347 (2012)
Title Collagen XII and XIV, new partners of cartilage oligomeric matrix protein in the skin extracellular matrix suprastructure .
Author Agarwal,P., Zwolanek,D., Keene,D.R., Schulz,J.N., Blumbach,K., Heinegard,D., Zaucke,F., Paulsson,M., Krieg,T., Koch,M. and Eckes,B.
Journal J. Biol. Chem. 287 (27), 22549-22559 (2012)
Title Increased serum COMP predicts mortality in SSc: results from a longitudinal study of interstitial lung disease .
Author Hesselstrand,R., Andreasson,K., Wuttge,D.M., Bozovic,G., Scheja,A. and Saxne,T.
Journal Rheumatology (Oxford) 51 (5), 915-920 (2012)
Title Serum COMP-C3b complexes in rheumatic diseases and relation to anti-TNF-alpha treatment .
Author Happonen,K.E., Saxne,T., Geborek,P., Andersson,M., Bengtsson,A.A., Hesselstrand,R., Heinegard,D. and Blom,A.M.
Journal Arthritis Res. Ther. 14 (1), R15 (2012)
Title Pseudoachondroplasia and multiple epiphyseal dysplasia due to mutations in the cartilage oligomeric matrix protein gene .
Author Briggs,M.D., Hoffman,S.M., King,L.M., Olsen,A.S., Mohrenweiser,H., Leroy,J.G., Mortier,G.R., Rimoin,D.L., Lachman,R.S., Gaines,E.S. et al.
Journal Nat. Genet. 10 (3), 330-336 (1995)
Title Mutations in exon 17B of cartilage oligomeric matrix protein (COMP) cause pseudoachondroplasia .
Author Hecht,J.T., Nelson,L.D., Crowder,E., Wang,Y., Elder,F.F., Harrison,W.R., Francomano,C.A., Prange,C.K., Lennon,G.G., Deere,M. et al.
Journal Nat. Genet. 10 (3), 325-329 (1995)
Title Cartilage and bone metabolism in rheumatoid arthritis. Differences between rapid and slow progression of disease identified by serum markers of cartilage metabolism .
Author Mansson,B., Carey,D., Alini,M., Ionescu,M., Rosenberg,L.C., Poole,A.R., Heinegard,D. and Saxne,T.
Journal J. Clin. Invest. 95 (3), 1071-1077 (1995)
Title Characterization of human and mouse cartilage oligomeric matrix protein .
Author Newton,G., Weremowicz,S., Morton,C.C., Copeland,N.G., Gilbert,D.J., Jenkins,N.A. and Lawler,J.
Journal Genomics 24 (3), 435-439 (1994)
Title Genetic linkage mapping of multiple epiphyseal dysplasia to the pericentromeric region of chromosome 19 .
Author Oehlmann,R., Summerville,G.P., Yeh,G., Weaver,E.J., Jimenez,S.A. and Knowlton,R.G.
Journal Am. J. Hum. Genet. 54 (1), 3-10 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878