• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens carnitine palmitoyltransferase 2 (CPT2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000098 Homo sapiens carnitine palmitoyltransferase 2 (CPT2), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000098.2, 169790951
Length 3110 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens carnitine palmitoyltransferase 2 (CPT2), mRNA.
Product carnitine O-palmitoyltransferase 2, mitochondrial precursor
Comment

Summary: The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders. [provided by RefSeq, Jul 2008].

RefSeq NP_000089.1
CDS 516..2492
Misc Feature(1)417..419
Misc Feature(2)657..2462
Misc Feature(3)1869..1907
Exon (1)1..667
Gene:CPT2
Gene Synonym:CPT1; CPTASE; IIAE4
Exon (2)668..748
Gene:CPT2
Gene Synonym:CPT1; CPTASE; IIAE4
Exon (3)749..855
Gene:CPT2
Gene Synonym:CPT1; CPTASE; IIAE4
Exon (4)856..2160
Gene:CPT2
Gene Synonym:CPT1; CPTASE; IIAE4
Exon (5)2161..3094
Gene:CPT2
Gene Synonym:CPT1; CPTASE; IIAE4
Translation MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDT IRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMY LSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNP AKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKA RHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDIWA ELRQKLMSSGNEESLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLII AKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELT DALKTGITAAKEKFDATMKTLTIDCVQFQRGGKEFLKKQKLSPDAVAQLAFQMAFLRQYG QTVATYESCSTAAFKHGRTETIRPASVYTKRCSEAFVREPSRHSAGELQQMMVECSKYHG QLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLG GFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
39+dbSNP:
39+c, tdbSNP:7545725
complement(55)-t, cdbSNP:17848481
341+a, tdbSNP:377231075
406+c, tdbSNP:369982767
complement(618)-g, adbSNP:2929073
664+a, cdbSNP:28936375
710+dbSNP:
710+c, gdbSNP:142598568
715+c, gdbSNP:201966320
725+c, tdbSNP:370633858
733+a, gdbSNP:146159244
739+a, gdbSNP:140194675
751+dbSNP:
751+a, cdbSNP:150888506
802+a, gdbSNP:369596290
817+c, tdbSNP:75939866
836+a, gdbSNP:147846614
840+a, cdbSNP:71654989
848+c, tdbSNP:372313619
853+c, tdbSNP:74315294
856+dbSNP:
856+a, gdbSNP:371560287
868+a, gdbSNP:148035648
874+a, gdbSNP:121918528
880+c, tdbSNP:192275019
885+c, tdbSNP:201065226
887+a, gdbSNP:200301403
894+a, gdbSNP:199545795
914+a, gdbSNP:375573986
931+a, cdbSNP:369475478
959+a, gdbSNP:144686779
963+a, gdbSNP:141505320
966+a, cdbSNP:200080591
983+c, tdbSNP:138938770
1015+a, gdbSNP:144760921
1026+c, tdbSNP:2229292
1035+a, gdbSNP:28936674
1071+a, cdbSNP:377737941
1092+c, tdbSNP:375968699
1103+c, tdbSNP:140853350
1148+a, cdbSNP:201622710
1153+a, gdbSNP:74315300
1170+c, tdbSNP:367691827
1191+c, tdbSNP:147889730
1195+c, tdbSNP:74315298
1206+c, tdbSNP:373638740
1207+a, gdbSNP:369369333
1213+a, gdbSNP:144805101
1236+a, gdbSNP:200252755
1240+a, gdbSNP:111896041
1279+a, gdbSNP:199673903
1282+g, tdbSNP:373918498
1358+c, tdbSNP:190459228
1361+c, tdbSNP:138855128
1365+c, tdbSNP:201163382
1367+c, tdbSNP:138575554
1368+a, gdbSNP:200906458
1385+c, tdbSNP:202145705
1392+a, gdbSNP:145237292
1427+g, tdbSNP:141553491
1445+c, tdbSNP:371971257
1447+a, gdbSNP:142790440
1502+c, gdbSNP:201165795
1531+c, tdbSNP:375109382
1540+c, tdbSNP:144658100
1562+c, tdbSNP:148512862
1563+c, tdbSNP:151003641
1570+g, tdbSNP:2229291
1587+c, tdbSNP:199894581
1617+a, gdbSNP:1799821
1653+c, gdbSNP:144875040
1658+c, gdbSNP:369847007
1663+a, tdbSNP:74315295
1704+a, gdbSNP:201745292
1717+g, tdbSNP:146670074
1744+c, tdbSNP:372102993
1747+c, tdbSNP:375957043
1748+c, gdbSNP:112914907
1753..1754+, agdbSNP:397509431
1754..1755+, gadbSNP:398123153
1762+a, gdbSNP:201008705
1768+a, gdbSNP:368989271
1774+a, cdbSNP:373420308
1793+c, tdbSNP:376445618
1799+a, gdbSNP:187044944
1827+a, gdbSNP:374201361
1828+a, tdbSNP:377616144
1850+c, tdbSNP:143075786
1857+c, tdbSNP:74315297
1875+g, tdbSNP:74315299
1887+a, cdbSNP:147276580
1904..1905+, gdbSNP:35237240
1907+c, tdbSNP:201681645
1912+c, tdbSNP:200399018
1919+a, gdbSNP:140771069
1937+a, cdbSNP:192779168
1943+a, gdbSNP:149557870
1952+c, tdbSNP:370157946
1953+a, gdbSNP:201508063
1966+c, gdbSNP:374183980
1973+c, tdbSNP:201241649
1975+a, cdbSNP:368132822
1979+a, cdbSNP:143486080
1992+a, gdbSNP:61731996
2003+c, tdbSNP:139321501
2007+c, tdbSNP:374308679
2022+c, tdbSNP:74315296
2026+c, tdbSNP:368311455
2027+g, tdbSNP:150953507
2033+c, tdbSNP:140798841
2034+a, gdbSNP:142600166
2051+c, tdbSNP:199573389
2053+a, cdbSNP:372368317
2060+c, tdbSNP:201663642
2062+c, tdbSNP:398123154
2093+c, tdbSNP:113493395
2113+c, tdbSNP:144703247
2117+a, gdbSNP:148110518
2149+a, cdbSNP:17848485
2161+dbSNP:
2161+a, gdbSNP:186044004
2172+a, gdbSNP:28936376
2176+a, gdbSNP:367796030
2189+g, tdbSNP:141814677
2194+a, gdbSNP:199996641
2195+a, gdbSNP:267598646
2255+a, gdbSNP:371443614
2278+c, gdbSNP:1871748
2282+a, gdbSNP:77565483
2291+a, gdbSNP:141146189
2321+c, tdbSNP:147953465
2335+c, gdbSNP:201913567
2364+c, tdbSNP:201996784
2398+a, cdbSNP:28936673
2403+g, tdbSNP:112676827
2406+c, tdbSNP:74315293
2412+g, tdbSNP:141903761
2416+a, gdbSNP:375766702
2451+a, gdbSNP:369202713
2454+a, gdbSNP:1799822
2456+a, gdbSNP:78266699
2458+c, tdbSNP:138125299
2478+c, tdbSNP:138893547
2479+a, cdbSNP:373714948
2499+a, gdbSNP:377159044
2514+a, tdbSNP:115408040
2547+c, tdbSNP:61561746
2552+a, gdbSNP:374043834
2554+a, c, gdbSNP:672
2567+c, tdbSNP:6702020
2608+c, tdbSNP:182988415
complement(2674)-t, cdbSNP:1134725
2740+c, tdbSNP:186214647
2755+a, gdbSNP:372200011
2771+g, tdbSNP:373212644
2793+a, gdbSNP:191416983
complement(2826)-t, cdbSNP:1056446
2989+c, tdbSNP:369718292
2990..2991+, aadbSNP:374495416
Gene SymbolCPT2
Gene SynonymCPT1; CPTASE; IIAE4
Chromosome1
Locus Map1p32
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000098 Homo sapiens carnitine palmitoyltransferase 2 (CPT2), mRNA. On-demand TBD TBD
XM_005270484 PREDICTED: Homo sapiens carnitine palmitoyltransferase 2 (CPT2), transcript variant X1, mRNA. On-demand TBD TBD
Title Single nucleotide polymorphism in CPT1B and CPT2 genes and its association with blood carnitine levels in acute myocardial infarction patients .
Author Khan HA and Alhomida AS.
Journal Gene 523 (1), 76-81 (2013)
Title Expanding mutation spectrum in CPT II gene: identification of four novel mutations .
Author Joshi,P.R., Young,P., Deschauer,M. and Zierz,S.
Journal J. Neurol. 260 (5), 1412-1414 (2013)
Title Carnitine palmitoyltransferase 2 and carnitine/acylcarnitine translocase are involved in the mitochondrial synthesis and export of acylcarnitines .
Author Violante S, Ijlst L, Te Brinke H, Tavares de Almeida I, Wanders RJ, Ventura FV and Houten SM.
Journal FASEB J. 27 (5), 2039-2044 (2013)
Title Allelic and phenotypic heterogeneity in 49 Italian patients with the muscle form of CPT-II deficiency .
Author Fanin M, Anichini A, Cassandrini D, Fiorillo C, Scapolan S, Minetti C, Cassanello M, Donati MA, Siciliano G, D'Amico A, Lilliu F, Bruno
Journal Clin. Genet. 82 (3), 232-239 (2012)
Title Fatal viral infection-associated encephalopathy in two Chinese boys: a genetically determined risk factor of thermolabile carnitine palmitoyltransferase II variants .
Author Mak CM, Lam CW, Fong NC, Siu WK, Lee HC, Siu TS, Lai CK, Law CY, Tong SF, Poon WT, Lam DS, Ng HL, Yuen YP, Tam S, Que TL, Kwong NS and Chan AY.
Journal J. Hum. Genet. 56 (8), 617-621 (2011)
Title Carnitine Palmitoyltransferase II Deficiency .
Author Wieser,T.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Molecular characterization of inherited carnitine palmitoyltransferase II deficiency .
Author Taroni F, Verderio E, Fiorucci S, Cavadini P, Finocchiaro G, Uziel G, Lamantea E, Gellera C and DiDonato S.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (18), 8429-8433 (1992)
Title cDNA cloning, sequence analysis, and chromosomal localization of human carnitine palmitoyltransferase .
Author Finocchiaro,G., Taroni,F., Rocchi,M., Liras Martin,A., Colombo,I., Tarelli,G.T. and DiDonato,S.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (23), 10981 (1991)
Title cDNA cloning, sequence analysis, and chromosomal localization of the gene for human carnitine palmitoyltransferase .
Author Finocchiaro G, Taroni F, Rocchi M, Martin AL, Colombo I, Tarelli GT and DiDonato S.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (2), 661-665 (1991)
Title Purification, characterization and partial amino acid sequences of carnitine palmitoyl-transferase from human liver .
Author Finocchiaro G, Colombo I and DiDonato S.
Journal FEBS Lett. 274 (1-2), 163-166 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.