• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens cystatin C (CST3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000099 Homo sapiens cystatin C (CST3), mRNA. GenEZ ORF Cloning In-stock $248.00 $199.00 10

*Business Day

Related Services

RefSeq Version NM_000099.2, 19882253
Length 818 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens cystatin C (CST3), mRNA.
Product cystatin-C precursor
Comment

Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease. [provided by RefSeq, Jul 2008].

RefSeq NP_000090.1
CDS 76..516
Misc Feature(1)67..69
Misc Feature(2)184..504
Misc Feature(3)order(184..186,316..324,328..330)
Misc Feature(4)184..186
Misc Feature(5)184..186
Misc Feature(6)238..240
Misc Feature(7)316..330
Misc Feature(8)343..345
Misc Feature(9)457..459
Misc Feature(10)487..489
Exon (1)1..318
Gene:CST3
Gene Synonym:ARMD11
Exon (2)319..432
Gene:CST3
Gene Synonym:ARMD11
Exon (3)433..775
Gene:CST3
Gene Synonym:ARMD11
Translation MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEY NKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRK AFCSFQIYAVPWQGTMTLSKSTCQDA
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(4)-dbSNP:
complement(4)-t, gdbSNP:73318135
complement(26..27)-, ggagctagatagagadbSNP:34505583
complement(27..28)-, ggagctagatagagadbSNP:11467210
complement(60)-c, adbSNP:11542361
complement(79)-c, adbSNP:200984369
complement(82)-g, adbSNP:11542357
complement(87)-t, cdbSNP:1055084
complement(124)-g, adbSNP:11542359
complement(131)-g, adbSNP:113550984
complement(144)-t, cdbSNP:11542356
complement(148)-g, adbSNP:1064039
complement(163)-t, cdbSNP:200245337
complement(174)-g, adbSNP:11542363
complement(180)-t, cdbSNP:6138024
complement(188)-g, cdbSNP:11542354
complement(192)-c, adbSNP:11542365
complement(213)-t, cdbSNP:201089355
complement(286)-c, adbSNP:11542364
complement(287)-g, adbSNP:11542360
complement(289)-c, adbSNP:202145575
complement(292)-g, adbSNP:111341893
complement(311)-g, adbSNP:11542353
complement(356)-dbSNP:
complement(356)-t, adbSNP:28939068
complement(361)-g, cdbSNP:11542355
complement(368)-g, adbSNP:200037041
complement(375)-g, adbSNP:200401591
complement(413)-t, gdbSNP:201184716
complement(424)-t, cdbSNP:1135036
complement(438)-dbSNP:
complement(438)-t, adbSNP:145812457
complement(443)-t, cdbSNP:149051742
complement(456)-t, cdbSNP:1135147
complement(459)-g, adbSNP:137970982
complement(492)-t, cdbSNP:77000936
complement(499)-t, cdbSNP:141643699
complement(510)-g, adbSNP:201422446
complement(528)-t, cdbSNP:200979591
complement(551)-t, cdbSNP:3209261
complement(562)-t, cdbSNP:11542358
complement(568)-c, adbSNP:11542362
complement(599)-c, adbSNP:11504
complement(633)-c, adbSNP:3199331
complement(648)-g, adbSNP:1058745
complement(666)-t, cdbSNP:14766
complement(673)-g, adbSNP:14767
complement(674)-t, cdbSNP:14768
complement(714)-t, cdbSNP:1059137
complement(747)-c, adbSNP:1059253
complement(765)-t, cdbSNP:55837531
complement(768)-t, cdbSNP:55686485
Gene SymbolCST3
Gene SynonymARMD11
Chromosome20
Locus Map20p11.21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000099 Homo sapiens cystatin C (CST3), mRNA. In-stock $248.00 $199.00 10
Title The influence of uremic high cystatin C concentration on neutrophil apoptosis and selected neutrophil functions isolated from healthy subjects .
Author Majewska,E., Wittek,N., Rysz,J. and Baj,Z.
Journal Med. Sci. Monit. 18 (11), CR667-CR673 (2012)
Title Serum cystatin C as a marker for early detection of chronic kidney disease and grade 2 nephropathy in Japanese patients with type 2 diabetes .
Author Suzuki,Y., Matsushita,K., Seimiya,M., Yoshida,T., Sawabe,Y., Ogawa,M. and Nomura,F.
Journal Clin. Chem. Lab. Med. 50 (10), 1833-1839 (2012)
Title Comparison of cystatin C- and creatinine-based glomerular filtration rate formulas with inulin clearance in pediatric renal transplantation .
Author Selistre,L., Roquet,O., Saitovitch,D., de Souza,V.C., Antonello,I.C., Ranchin,B., Hadj-Aissa,A., Cochat,P. and Dubourg,L.
Journal Transplant. Proc. 44 (8), 2357-2359 (2012)
Title A comparison between serum creatinine and cystatin C-based equations for estimation of graft function .
Author Malheiro,J., Fonseca,I., Martins,L.S., Almeida,M., Pedroso,S., Dias,L., Henriques,A.C. and Cabrita,A.
Journal Transplant. Proc. 44 (8), 2352-2356 (2012)
Title Simple cystatin C formula for estimation of glomerular filtration rate in overweight patients with diabetes mellitus type 2 and chronic kidney disease .
Author Bevc,S., Hojs,R., Ekart,R., Zavrsnik,M., Gorenjak,M. and Puklavec,L.
Journal Exp Diabetes Res 2012, 179849 (2012)
Title Hereditary cystatin C amyloid angiopathy: identification of the disease-causing mutation and specific diagnosis by polymerase chain reaction based analysis .
Author Abrahamson,M., Jonsdottir,S., Olafsson,I., Jensson,O. and Grubb,A.
Journal Hum. Genet. 89 (4), 377-380 (1992)
Title Interaction of recombinant human cystatin C with the cysteine proteinases papain and actinidin .
Author Lindahl,P., Abrahamson,M. and Bjork,I.
Journal Biochem. J. 281 (PT 1), 49-55 (1992)
Title Inactivation of human cystatin C and kininogen by human cathepsin D .
Author Lenarcic,B., Krasovec,M., Ritonja,A., Olafsson,I. and Turk,V.
Journal FEBS Lett. 280 (2), 211-215 (1991)
Title Human cystatin C. role of the N-terminal segment in the inhibition of human cysteine proteinases and in its inactivation by leucocyte elastase .
Author Abrahamson,M., Mason,R.W., Hansson,H., Buttle,D.J., Grubb,A. and Ohlsson,K.
Journal Biochem. J. 273 (PT 3), 621-626 (1991)
Title Binding of cystatin C to C4: the importance of sense-antisense peptides in their interaction .
Author Ghiso,J., Saball,E., Leoni,J., Rostagno,A. and Frangione,B.
Journal Proc. Natl. Acad. Sci. U.S.A. 87 (4), 1288-1291 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.