• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens damage-specific DNA binding protein 2, 48kDa (DDB2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000107 Homo sapiens damage-specific DNA binding protein 2, 48kDa (DDB2), mRNA. GenEZ ORF Cloning In-stock $509.00 $460.00 12

*Business Day

Related Services

RefSeq Version NM_000107.2, 164419759
Length 1870 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens damage-specific DNA binding protein 2, 48kDa (DDB2), mRNA.
Product DNA damage-binding protein 2
Comment

Summary: This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities. [provided by RefSeq, Jul 2008].

RefSeq NP_000098.1
CDS 196..1479
Misc Feature(1)163..165
Misc Feature(2)265..267
Misc Feature(3)265..267
Misc Feature(4)265..267
Misc Feature(5)271..273
Misc Feature(6)271..273
Misc Feature(7)397..432
Misc Feature(8)454..489
Misc Feature(9)520..642
Misc Feature(10)<526..1341
Misc Feature(11)538..1425
Misc Feature(12)order(580..582,592..594,610..615,649..651,658..660,
Misc Feature(13)655..780
Misc Feature(14)913..1035
Misc Feature(15)961..1017
Misc Feature(16)1051..1170
Misc Feature(17)1360..1473
Exon (1)1..322
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (2)323..459
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (3)460..651
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (4)652..797
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (5)798..897
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (6)898..1075
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (7)1076..1218
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (8)1219..1383
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (9)1384..1429
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (10)1430..1848
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Translation MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ EEARTRK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
10+dbSNP:
10+c, gdbSNP:137929910
36+g, tdbSNP:188348077
76+a, gdbSNP:4647707
149+c, g, tdbSNP:4647708
151+a, gdbSNP:180861241
160+a, gdbSNP:201317629
247+c, tdbSNP:201229167
274+a, cdbSNP:148175447
325+dbSNP:
325+c, gdbSNP:141990819
361+g, tdbSNP:150620642
384+g, tdbSNP:191773047
395+a, gdbSNP:139674102
413+a, tdbSNP:199630230
476+dbSNP:
476+g, tdbSNP:144729572
500+a, gdbSNP:201842334
514+a, gdbSNP:11537594
518+c, gdbSNP:78651238
573+a, c, gdbSNP:326212
593+c, gdbSNP:139968905
595+a, gdbSNP:200856208
645+a, cdbSNP:145264146
706+dbSNP:
706+c, gdbSNP:201703288
769+c, tdbSNP:199822504
772+a, gdbSNP:200406558
835+dbSNP:
835+c, tdbSNP:144989465
839+c, tdbSNP:4647750
867+a, cdbSNP:201525567
869+c, tdbSNP:202083037
884+c, tdbSNP:139325563
888+c, tdbSNP:149583624
891+c, tdbSNP:142203542
925+dbSNP:
925+a, gdbSNP:121434639
932+a, cdbSNP:151146343
933+a, gdbSNP:144266685
946..947+, cdbSNP:35644155
981+c, tdbSNP:200094631
988+a, cdbSNP:201259165
1013+a, gdbSNP:121434640
1057+a, gdbSNP:145241266
1072+a, gdbSNP:4647751
1089+dbSNP:
1089+c, tdbSNP:137958929
1113+a, gdbSNP:140886714
1114+g, tdbSNP:121434642
1132+c, tdbSNP:121434641
1178+c, tdbSNP:145822896
1179+a, gdbSNP:138255134
1212+c, tdbSNP:17849262
1248+dbSNP:
1248+c, tdbSNP:61741581
1308+a, gdbSNP:144368453
1315+a, gdbSNP:148299549
1320+c, tdbSNP:185380045
1362+a, gdbSNP:199920301
1423+dbSNP:
1423+a, gdbSNP:143049891
1476+dbSNP:
1476+c, gdbSNP:77897070
1502+c, tdbSNP:200353341
1556+c, tdbSNP:1050244
1630+a, cdbSNP:4647760
1764..1765+, adbSNP:36044881
1812..1813+, cadbSNP:4647761
Gene SymbolDDB2
Gene SynonymDDBB; UV-DDB2
Chromosome11
Locus Map11p12-p11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000107 Homo sapiens damage-specific DNA binding protein 2, 48kDa (DDB2), mRNA. In-stock $509.00 $460.00 12
Title DDB2 is a novel AR interacting protein and mediates AR ubiquitination/degradation .
Author Chang,S.W., Su,C.H., Chen,H.H., Huang,C.W., Tsao,L.P., Tsao,Y.P. and Chen,S.L.
Journal Int. J. Biochem. Cell Biol. 44 (11), 1952-1961 (2012)
Title PARP1 promotes nucleotide excision repair through DDB2 stabilization and recruitment of ALC1 .
Author Pines,A., Vrouwe,M.G., Marteijn,J.A., Typas,D., Luijsterburg,M.S., Cansoy,M., Hensbergen,P., Deelder,A., de Groot,A., Matsumoto,S., Sugasawa,K., Thoma,N., Vermeulen,W., Vrieling,H. and Mullenders,L.
Journal J. Cell Biol. 199 (2), 235-249 (2012)
Title Damaged DNA induced UV-damaged DNA-binding protein (UV-DDB) dimerization and its roles in chromatinized DNA repair .
Author Yeh,J.I., Levine,A.S., Du,S., Chinte,U., Ghodke,H., Wang,H., Shi,H., Hsieh,C.L., Conway,J.F., Van Houten,B. and Rapic-Otrin,V.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (41), E2737-E2746 (2012)
Title DDB2 promotes chromatin decondensation at UV-induced DNA damage .
Author Luijsterburg,M.S., Lindh,M., Acs,K., Vrouwe,M.G., Pines,A., van Attikum,H., Mullenders,L.H. and Dantuma,N.P.
Journal J. Cell Biol. 197 (2), 267-281 (2012)
Title Regulation of nucleotide excision repair by UV-DDB: prioritization of damage recognition to internucleosomal DNA .
Author Fei,J., Kaczmarek,N., Luch,A., Glas,A., Carell,T. and Naegeli,H.
Journal PLoS Biol. 9 (10), E1001183 (2011)
Title DNA damage recognition during nucleotide excision repair in mammalian cells .
Author Wood,R.D.
Journal Biochimie 81 (1-2), 39-44 (1999)
Title DDB, a putative DNA repair protein, can function as a transcriptional partner of E2F1 .
Author Hayes,S., Shiyanov,P., Chen,X. and Raychaudhuri,P.
Journal Mol. Cell. Biol. 18 (1), 240-249 (1998)
Title Mutations specific to the xeroderma pigmentosum group E Ddb- phenotype .
Author Nichols,A.F., Ong,P. and Linn,S.
Journal J. Biol. Chem. 271 (40), 24317-24320 (1996)
Title Chromosomal localization and cDNA cloning of the genes (DDB1 and DDB2) for the p127 and p48 subunits of a human damage-specific DNA binding protein .
Author Dualan,R., Brody,T., Keeney,S., Nichols,A.F., Admon,A. and Linn,S.
Journal Genomics 29 (1), 62-69 (1995)
Title Characterization of a human DNA damage binding protein implicated in xeroderma pigmentosum E .
Author Keeney,S., Chang,G.J. and Linn,S.
Journal J. Biol. Chem. 268 (28), 21293-21300 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.