• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens damage-specific DNA binding protein 2, 48kDa (DDB2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19345 Homo sapiens damage-specific DNA binding protein 2, 48kDa (DDB2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19345C Homo sapiens damage-specific DNA binding protein 2, 48kDa (DDB2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000107.2, 164419759
Length 1284 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens damage-specific DNA binding protein 2, 48kDa (DDB2), mRNA.
Product DNA damage-binding protein 2
Comment

Summary: This gene encodes a protein that is necessary for the repair of ultraviolet light-damaged DNA. This protein is the smaller subunit of a heterodimeric protein complex that participates in nucleotide excision repair, and this complex mediates the ubiquitylation of histones H3 and H4, which facilitates the cellular response to DNA damage. This subunit appears to be required for DNA binding. Mutations in this gene cause xeroderma pigmentosum complementation group E, a recessive disease that is characterized by an increased sensitivity to UV light and a high predisposition for skin cancer development, in some cases accompanied by neurological abnormalities. [provided by RefSeq, Jul 2008].

RefSeq NP_000098.1
CDS 196..1479
Misc Feature(1)163..165
Misc Feature(2)265..267
Misc Feature(3)265..267
Misc Feature(4)265..267
Misc Feature(5)271..273
Misc Feature(6)271..273
Misc Feature(7)397..>1452
Misc Feature(8)397..432
Misc Feature(9)454..489
Misc Feature(10)538..1452
Misc Feature(11)541..648
Misc Feature(12)order(580..582,592..594,610..615,649..651,658..660,
Misc Feature(13)670..777
Misc Feature(14)802..909
Misc Feature(15)925..1056
Misc Feature(16)961..1017
Misc Feature(17)1063..1182
Misc Feature(18)1195..1203
Misc Feature(19)1222..1353
Misc Feature(20)1381..1455
Exon (1)1..322
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (2)323..459
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (3)460..651
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (4)652..797
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (5)798..897
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (6)898..1075
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (7)1076..1218
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (8)1219..1383
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (9)1384..1429
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Exon (10)1430..1848
Gene:DDB2
Gene Synonym:DDBB; UV-DDB2
Translation MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ EEARTRK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
10+dbSNP:
10+c, gdbSNP:137929910
36+g, tdbSNP:188348077
76+a, gdbSNP:4647707
149+c, g, tdbSNP:4647708
151+a, gdbSNP:180861241
160+a, gdbSNP:201317629
165+c, gdbSNP:375840702
175+c, tdbSNP:367717420
186+c, gdbSNP:371281878
187+a, gdbSNP:376193077
215+c, tdbSNP:369110013
247+c, tdbSNP:201229167
254+a, gdbSNP:373622283
274+a, cdbSNP:148175447
307+g, tdbSNP:368073045
325+dbSNP:
325+c, gdbSNP:141990819
361+g, tdbSNP:150620642
384+g, tdbSNP:191773047
395+a, gdbSNP:139674102
413+a, tdbSNP:199630230
476+dbSNP:
476+g, tdbSNP:144729572
500+a, gdbSNP:201842334
514+a, gdbSNP:11537594
518+c, gdbSNP:78651238
573+a, gdbSNP:386486167
complement(573)-g, c, adbSNP:326212
593+c, gdbSNP:139968905
595+a, gdbSNP:200856208
645+a, cdbSNP:145264146
669+dbSNP:
669+c, tdbSNP:370540741
706+c, gdbSNP:201703288
769+c, tdbSNP:199822504
772+a, gdbSNP:200406558
835+dbSNP:
835+c, tdbSNP:144989465
836+a, gdbSNP:370654581
839+c, tdbSNP:4647750
867+a, cdbSNP:201525567
869+c, tdbSNP:202083037
884+c, tdbSNP:139325563
888+c, tdbSNP:149583624
891+c, tdbSNP:142203542
925+dbSNP:
925+a, gdbSNP:121434639
932+a, cdbSNP:151146343
933+a, gdbSNP:144266685
946..947+, cdbSNP:35644155
981+c, tdbSNP:200094631
988+a, cdbSNP:201259165
1013+a, gdbSNP:121434640
1052+c, tdbSNP:373044335
1057+a, gdbSNP:145241266
1065+c, tdbSNP:376783024
1072+a, gdbSNP:4647751
1089+dbSNP:
1089+c, tdbSNP:137958929
1113+a, gdbSNP:140886714
1114+g, tdbSNP:121434642
1132+c, tdbSNP:121434641
1142+c, tdbSNP:375788966
1151+a, gdbSNP:370130760
1178+c, tdbSNP:145822896
1179+a, gdbSNP:138255134
1212+c, tdbSNP:17849262
1234+dbSNP:
1234+c, tdbSNP:376083611
1248+c, tdbSNP:61741581
1308+a, gdbSNP:144368453
1315+a, gdbSNP:148299549
1320+c, tdbSNP:185380045
1321+a, gdbSNP:375649516
1362+a, gdbSNP:199920301
1423+dbSNP:
1423+a, gdbSNP:143049891
1473+dbSNP:
1473+g, tdbSNP:369378109
1476+c, gdbSNP:77897070
1502+c, tdbSNP:200353341
1529+a, gdbSNP:373315783
1556+c, tdbSNP:1050244
1630+a, cdbSNP:4647760
1764..1765+, adbSNP:36044881
1812..1813+, cadbSNP:4647761
Gene SymbolDDB2
Gene SynonymDDBB; UV-DDB2
Chromosome11
Locus Map11p12-p11
Title A novel DDB2-ATM feedback loop regulates human cytomegalovirus replication .
Author E X, Savidis G, Chin CR, Wang S, Lu S, Brass AL and Kowalik TF.
Journal J. Virol. 88 (4), 2279-2290 (2014)
Title SUMOylation of damaged DNA-binding protein DDB2 .
Author Tsuge M, Masuda Y, Kaneoka H, Kidani S, Miyake K and Iijima S.
Journal Biochem. Biophys. Res. Commun. 438 (1), 26-31 (2013)
Title DDB2: a novel regulator of NF-kappaB and breast tumor invasion .
Author Ennen M, Klotz R, Touche N, Pinel S, Barbieux C, Besancenot V, Brunner E, Thiebaut D, Jung AC, Ledrappier S, Domenjoud L, Abecassis J, Plenat F, Grandemange S and Becuwe P.
Journal Cancer Res. 73 (16), 5040-5052 (2013)
Title DDB2 suppresses epithelial-to-mesenchymal transition in colon cancer .
Author Roy N, Bommi PV, Bhat UG, Bhattacharjee S, Elangovan I, Li J, Patra KC, Kopanja D, Blunier A, Benya R, Bagchi S and Raychaudhuri P.
Journal Cancer Res. 73 (12), 3771-3782 (2013)
Title A novel cis-acting element from the 3'UTR of DNA damage-binding protein 2 mRNA links transcriptional and post-transcriptional regulation of gene expression .
Author Melanson BD, Cabrita MA, Bose R, Hamill JD, Pan E, Brochu C, Marcellus KA, Zhao TT, Holcik M and McKay BC.
Journal Nucleic Acids Res. 41 (11), 5692-5703 (2013)
Title DDB, a putative DNA repair protein, can function as a transcriptional partner of E2F1 .
Author Hayes S, Shiyanov P, Chen X and Raychaudhuri P.
Journal Mol. Cell. Biol. 18 (1), 240-249 (1998)
Title Mutations specific to the xeroderma pigmentosum group E Ddb- phenotype .
Author Nichols AF, Ong P and Linn S.
Journal J. Biol. Chem. 271 (40), 24317-24320 (1996)
Title Chromosomal localization and cDNA cloning of the genes (DDB1 and DDB2) for the p127 and p48 subunits of a human damage-specific DNA binding protein .
Author Dualan R, Brody T, Keeney S, Nichols AF, Admon A and Linn S.
Journal Genomics 29 (1), 62-69 (1995)
Title Characterization of a human DNA damage binding protein implicated in xeroderma pigmentosum E .
Author Keeney S, Chang GJ and Linn S.
Journal J. Biol. Chem. 268 (28), 21293-21300 (1993)
Title Xeroderma Pigmentosum .
Author Kraemer,K.H. and DiGiovanna,J.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.