• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens dihydropyrimidine dehydrogenase (DPYD), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19551 Homo sapiens dihydropyrimidine dehydrogenase (DPYD), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu19551C Homo sapiens dihydropyrimidine dehydrogenase (DPYD), transcript variant 1, mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000110.3, 119943097
Length 3078 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens dihydropyrimidine dehydrogenase (DPYD), transcript variant 1, mRNA.
Product dihydropyrimidine dehydrogenase [NADP(+)] isoform 1
Comment

Summary: The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_000101.2
CDS 138..3215
Misc Feature(1)37
Misc Feature(2)37
Misc Feature(3)294..1676
Misc Feature(4)294..1676
Misc Feature(5)309..635
Misc Feature(6)717..>851
Misc Feature(7)1287..1289
Misc Feature(8)1731..3158
Misc Feature(9)1731..2639
Misc Feature(10)order(1791..1796,1806..1814,1818..1823,1884..1892,
Misc Feature(11)order(1857..1862,1905..1907,1962..1964,1968..1970,
Misc Feature(12)order(1857..1859,1905..1907,1962..1964,1968..1970,
Misc Feature(13)order(1962..1964,1968..1970,2139..2141,2145..2147,
Misc Feature(14)2139..2147
Misc Feature(15)2343..2348
Misc Feature(16)2988..3128
Exon (1)1..176
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (2)177..287
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (3)288..370
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (4)371..458
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (5)459..620
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (6)621..817
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (7)818..899
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (8)900..987
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (9)988..1095
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (10)1096..1265
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (11)1266..1476
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (12)1477..1661
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (13)1662..1877
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (14)1878..2042
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (15)2043..2111
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (16)2112..2195
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (17)2196..2316
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (18)2317..2436
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (19)2437..2579
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (20)2580..2759
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (21)2760..2903
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (22)2904..3044
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Exon (23)3045..4448
Gene:DPYD
Gene Synonym:DHP; DHPDHASE; DPD
Translation MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFD DIKHTTLGERGALREAMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDN PLGLTCGMVCPTSDLCVGGCNLYATEEGPINIGGLQQFATEVFKAMSIPQIRNPSLPPPE KMSEAYSAKIALFGAGPASISCASFLARLGYSDITIFEKQEYVGGLSTSEIPQFRLPYDV VNFEIELMKDLGVKIICGKSLSVNEMTLSTLKEKGYKAAFIGIGLPEPNKDAIFQGLTQD QGFYTSKDFLPLVAKGSKAGMCACHSPLPSIRGVVIVLGAGDTAFDCATSALRCGARRVF IVFRKGFVNIRAVPEEMELAKEEKCEFLPFLSPRKVIVKGGRIVAMQFVRTEQDETGKWN EDEDQMVHLKADVVISAFGSVLSDPKVKEALSPIKFNRWGLPEVDPETMQTSEAWVFAGG DVVGLANTTVESVNDGKQASWYIHKYVQSQYGASVSAKPELPLFYTPIDLVDISVEMAGL KFINPFGLASATPATSTSMIRRAFEAGWGFALTKTFSLDKDIVTNVSPRIIRGTTSGPMY GPGQSSFLNIELISEKTAAYWCQSVTELKADFPDNIVIASIMCSYNKNDWTELAKKSEDS GADALELNLSCPHGMGERGMGLACGQDPELVRNICRWVRQAVQIPFFAKLTPNVTDIVSI ARAAKEGGANGVTATNTVSGLMGLKSDGTPWPAVGIAKRTTYGGVSGTAIRPIALRAVTS IARALPGFPILATGGIDSAESGLQFLHSGASVLQVCSAIQNQDFTVIEDYCTGLKALLYL KSIEELQDWDGQSPATVSHQKGKPVPRIAELMDKKLPSFGPYLEQRKKIIAENKIRLKEQ NVAFSPLKRNCFIPKRPIPTIKDVIGKALQYLGTFGELSNVEQVVAMIDEEMCINCGKCY MTCNDSGYQAIQFDPETHLPTITDTCTGCTLCLSVCPIVDCIKMVSRTTPYEPKRGVPLS VNPVC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(173)-g, cdbSNP:376273539
complement(182)-dbSNP:
complement(182)-g, adbSNP:267598790
complement(183)-g, cdbSNP:150036960
complement(198)-g, adbSNP:72549310
complement(199)-t, cdbSNP:80081766
complement(199)-t, cdbSNP:386508633
222+c, tdbSNP:1801265
complement(287)-g, adbSNP:370036611
complement(302)-dbSNP:
complement(302)-t, cdbSNP:139126323
complement(323)-g, adbSNP:181215161
complement(324)-t, cdbSNP:367619008
complement(331)-g, adbSNP:371587702
complement(345)-g, adbSNP:141597515
complement(357)-g, adbSNP:189768576
complement(395)-dbSNP:
complement(395)-t, cdbSNP:201841475
complement(411)-g, cdbSNP:143986398
complement(427)-g, adbSNP:375990187
complement(432..435)-, atgadbSNP:72549309
complement(450)-t, cdbSNP:150385342
complement(479)-dbSNP:
complement(479)-c, adbSNP:370615432
complement(480)-t, cdbSNP:141462178
complement(482)-g, cdbSNP:377169736
complement(581)-t, cdbSNP:56108357
complement(588)-t, cdbSNP:200562975
complement(600)-g, adbSNP:201443458
complement(611)-g, adbSNP:190771411
complement(626)-dbSNP:
complement(626)-t, gdbSNP:368970772
complement(633)-t, cdbSNP:2297595
complement(635)-t, cdbSNP:139834141
complement(658)-g, cdbSNP:374827081
complement(661)-g, adbSNP:371792178
complement(662)-t, cdbSNP:6670886
complement(690)-t, cdbSNP:374531732
complement(694)-t, cdbSNP:115232898
complement(705)-t, cdbSNP:368152149
complement(707)-g, adbSNP:149843476
complement(738)-t, gdbSNP:72549308
complement(760)-t, cdbSNP:376073289
complement(769)-t, cdbSNP:72549307
complement(776)-g, adbSNP:190048823
complement(798)-c, adbSNP:146170505
840+dbSNP:
840+c, tdbSNP:1801266
complement(840)-g, adbSNP:386545627
complement(846)-g, adbSNP:267598789
complement(848)-t, cdbSNP:139863300
complement(876)-t, gdbSNP:376128878
complement(893)-g, adbSNP:6675198
complement(909)-dbSNP:
complement(909)-t, cdbSNP:141726921
complement(912)-t, cdbSNP:45589337
complement(944)-g, adbSNP:200702346
complement(979)-g, adbSNP:369103276
complement(1005)-dbSNP:
complement(1005)-t, cdbSNP:146356975
complement(1013)-g, adbSNP:187484874
complement(1030)-t, gdbSNP:143879757
complement(1031)-t, cdbSNP:61758443
complement(1047)-g, adbSNP:183105782
complement(1066)-g, adbSNP:150437414
complement(1071)-g, adbSNP:145112791
complement(1104)-dbSNP:
complement(1104)-t, cdbSNP:201018345
complement(1112)-g, adbSNP:141376128
complement(1116)-g, adbSNP:369575517
complement(1140)-c, adbSNP:72549306
complement(1161)-t, cdbSNP:183385770
complement(1172)-t, cdbSNP:1042478
complement(1172)-g, adbSNP:386512901
complement(1191)-g, cdbSNP:190577302
complement(1194)-g, adbSNP:143154602
complement(1207)-t, cdbSNP:377143350
1211+a, tdbSNP:1042479
complement(1220)-g, adbSNP:372369973
complement(1245)-t, cdbSNP:72549305
complement(1257)-g, adbSNP:201785202
complement(1266)-dbSNP:
complement(1266)-t, cdbSNP:144935781
complement(1269)-g, cdbSNP:201648613
1271+a, gdbSNP:1126741
complement(1277)-g, adbSNP:150759598
complement(1293)-c, adbSNP:78060119
complement(1293)-c, adbSNP:386508634
complement(1317)-g, adbSNP:140602333
complement(1318)-c, adbSNP:143815742
complement(1346)-g, adbSNP:267598788
complement(1355)-t, cdbSNP:61622928
complement(1366)-t, cdbSNP:199646142
complement(1373)-t, cdbSNP:56038477
complement(1391)-t, cdbSNP:141370079
complement(1397)-t, adbSNP:200064537
complement(1417)-g, adbSNP:200693895
complement(1431)-t, cdbSNP:142512579
complement(1444)-g, cdbSNP:370569731
complement(1451)-c, adbSNP:186169810
complement(1474)-t, gdbSNP:200709381
complement(1486)-dbSNP:
complement(1486)-g, adbSNP:72975710
complement(1495)-g, cdbSNP:144395748
complement(1508)-g, adbSNP:57918000
complement(1528)-g, adbSNP:370707404
complement(1529)-t, cdbSNP:373724295
complement(1540)-t, gdbSNP:199549923
complement(1583)-g, adbSNP:376470184
complement(1584)-t, cdbSNP:141439344
complement(1612)-g, adbSNP:72549304
complement(1621)-t, cdbSNP:111858276
complement(1631)-t, cdbSNP:116364703
complement(1655)-g, adbSNP:201166313
complement(1656)-t, cdbSNP:138391898
complement(1658)-t, adbSNP:373838132
complement(1680)-dbSNP:
complement(1680)-t, cdbSNP:148994843
complement(1691)-t, cdbSNP:369465750
complement(1697)-t, cdbSNP:138979515
complement(1714)-g, cdbSNP:190951787
complement(1724)-g, adbSNP:140125782
complement(1738)-g, adbSNP:1801158
complement(1752)-t, cdbSNP:142619737
1764+a, gdbSNP:1801159
complement(1764)-g, adbSNP:386545620
complement(1782)-g, cdbSNP:140039091
complement(1787)-g, adbSNP:149101842
complement(1816)-t, c, adbSNP:55886062
complement(1819)-c, adbSNP:201615754
complement(1838)-t, adbSNP:148372305
complement(1894)-dbSNP:
complement(1894)-g, adbSNP:374527058
complement(1911)-g, adbSNP:59086055
complement(1912)-t, cdbSNP:138616379
complement(1914)-t, cdbSNP:145773863
complement(1933)-g, adbSNP:147601618
complement(1945)-t, cdbSNP:371258350
complement(1973)-t, gdbSNP:151216654
complement(1983)-t, gdbSNP:368146607
complement(2002)-t, cdbSNP:201433243
complement(2033)-g, adbSNP:17376848
2035+, cdbSNP:72549303
complement(2038)-t, cdbSNP:200296941
complement(2042)-t, cdbSNP:386589336
2042+c, g, tdbSNP:3918289
complement(2043)-dbSNP:
complement(2043)-t, gdbSNP:55971861
complement(2090)-t, cdbSNP:267598787
complement(2127)-dbSNP:
complement(2127)-c, adbSNP:138545885
complement(2158)-t, cdbSNP:137999090
complement(2176)-g, adbSNP:187713395
complement(2186)-g, cdbSNP:183475941
complement(2208)-dbSNP:
complement(2208)-c, adbSNP:202212118
complement(2212)-t, cdbSNP:375436137
complement(2298)-t, cdbSNP:145548112
complement(2323)-dbSNP:
complement(2323)-g, adbSNP:146529561
complement(2330)-g, adbSNP:139543981
2331+a, gdbSNP:1801160
complement(2332)-c, adbSNP:60511679
complement(2349)-g, cdbSNP:368327291
complement(2413)-t, cdbSNP:267598786
complement(2416)-g, adbSNP:112766203
complement(2440)-dbSNP:
complement(2440)-t, gdbSNP:56005131
complement(2461)-c, adbSNP:200643089
complement(2467)-t, gdbSNP:374825099
complement(2473)-t, gdbSNP:199634007
complement(2474)-g, adbSNP:372413776
complement(2502)-g, adbSNP:267598785
complement(2520)-t, cdbSNP:147800606
complement(2555)-g, adbSNP:144271454
complement(2558)-g, adbSNP:55725052
complement(2571)-t, cdbSNP:371313778
complement(2615)-dbSNP:
complement(2615)-g, cdbSNP:201575324
complement(2619)-t, g, cdbSNP:200687447
complement(2622)-t, cdbSNP:199777072
complement(2664)-t, cdbSNP:372058915
complement(2719)-t, cdbSNP:60139309
complement(2741)-t, cdbSNP:372909322
complement(2757)-t, cdbSNP:368519011
complement(2760)-dbSNP:
complement(2760)-t, gdbSNP:201035051
complement(2776)-c, adbSNP:55674432
complement(2793)-g, adbSNP:147545709
complement(2794)-g, adbSNP:386545628
complement(2810)-t, cdbSNP:376391343
complement(2815)-t, cdbSNP:188052243
complement(2939)-dbSNP:
complement(2939)-t, adbSNP:377152743
complement(2943)-c, adbSNP:137878450
complement(2980)-t, adbSNP:372307932
complement(2983)-t, adbSNP:67376798
complement(2983)-t, adbSNP:386467430
complement(3009)-t, cdbSNP:141044036
complement(3023)-g, adbSNP:368617815
complement(3052)-dbSNP:
complement(3052)-t, cdbSNP:145529148
complement(3058)-t, adbSNP:72547602
complement(3068)-g, cdbSNP:376502495
complement(3070)-t, cdbSNP:72547601
complement(3071)-t, gdbSNP:201268750
complement(3085)-g, adbSNP:61757362
complement(3114)-g, adbSNP:202144771
complement(3115)-c, adbSNP:139459586
complement(3118)-g, cdbSNP:140989814
complement(3120)-t, gdbSNP:1801268
complement(3120)-c, adbSNP:386545629
complement(3135)-t, cdbSNP:151074666
complement(3186)-t, cdbSNP:140114515
complement(3198)-g, cdbSNP:148799944
complement(3204)-t, gdbSNP:114096998
complement(3229)-t, cdbSNP:374367724
complement(3267)-t, cdbSNP:370005502
complement(3320)-g, adbSNP:184161277
complement(3322)-g, adbSNP:150499371
complement(3374)-t, cdbSNP:55938520
complement(3489)-g, adbSNP:56160474
complement(3523)-t, cdbSNP:111295312
complement(3543)-g, adbSNP:192715981
complement(3647)-t, adbSNP:188501488
3650+a, tdbSNP:1042480
3681+a, cdbSNP:2635723
complement(3705..3706)-, ttdbSNP:367554694
complement(3770..3771)-, gdbSNP:34856860
3775+a, gdbSNP:1042481
3788+a, gdbSNP:1042482
complement(3827)-t, cdbSNP:75542363
complement(3983..3995)-atatgtgcacagt, gtatgtgcacagcdbSNP:386633699
3983+a, gdbSNP:291592
3995+c, tdbSNP:291593
complement(3998)-c, adbSNP:137984871
complement(4115)-g, adbSNP:17470762
complement(4123)-c, adbSNP:55696854
complement(4261)-t, gdbSNP:55992536
complement(4277)-t, cdbSNP:41285690
complement(4309)-t, cdbSNP:55921233
complement(4383)-g, adbSNP:113520437
Gene SymbolDPYD
Gene SynonymDHP; DHPDHASE; DPD
Chromosome1
Locus Map1p22
Title Somatic copy number changes in DPYD are associated with lower risk of recurrence in triple-negative breast cancers .
Author Gross E, Meul C, Raab S, Propping C, Avril S, Aubele M, Gkazepis A, Schuster T, Grebenchtchikov N, Schmitt M, Kiechle M, Meijer J, Vijzelaar R, Meindl A and van Kuilenburg AB.
Journal Br. J. Cancer 109 (9), 2347-2355 (2013)
Title Genome-wide association analysis identifies 13 new risk loci for schizophrenia .
Author Ripke S, O'Dushlaine C, Chambert K, Moran JL, Kahler AK, Akterin S, Bergen SE, Collins AL, Crowley JJ, Fromer M, Kim Y, Lee SH, Magnusson PK, Sanchez N, Stahl EA, Williams S, Wray NR, Xia K, Bettella F, Borglum AD, Bulik-Sullivan BK, Cormican P, Craddock N, de Leeuw C, Durmishi N, Gill M, Golimbet V, Hamshere ML, Holmans P, Hougaard DM, Kendler KS, Lin K, Morris DW, Mors O, Mortensen PB, Neale BM, O'Neill FA, Owen MJ, Milovancevic MP, Posthuma D, Powell J, Richards AL, Riley BP, Ruderfer D, Rujescu D, Sigurdsson E, Silagadze T, Smit AB, Stefansson H, Steinberg S, Suvisaari J, Tosato S, Verhage M, Walters JT, Levinson DF, Gejman PV, Kendler KS, Laurent C, Mowry BJ, O'Donovan MC, Owen MJ, Pulver AE, Riley BP, Schwab SG, Wildenauer DB, Dudbridge F, Holmans P, Shi J, Albus M, Alexander M, Campion D, Cohen D, Dikeos D, Duan J, Eichhammer P, Godard S, Hansen M, Lerer FB, Liang KY, Maier W, Mallet J, Nertney DA, Nestadt G, Norton N, O'Neill FA, Papadimitriou GN, Ribble R, Sanders AR, Silverman JM, Walsh D, Williams NM, Wormley B, Arranz MJ, Bakker S, Bender S, Bramon E, Collier D, Crespo-Facorro B, Hall J, Iyegbe C, Jablensky A, Kahn RS, Kalaydjieva L, Lawrie S, Lewis CM, Lin K, Linszen DH, Mata I, McIntosh A, Murray RM, Ophoff RA, Powell J, Rujescu D, Van Os J, Walshe M, Weisbrod M, Wiersma D, Donnelly P, Barroso I, Blackwell JM, Bramon E, Brown MA, Casas JP, Corvin AP, Deloukas P, Duncanson A, Jankowski J, Markus HS, Mathew CG, Palmer CN, Plomin R, Rautanen A, Sawcer SJ, Trembath RC, Viswanathan AC, Wood NW, Spencer CC, Band G, Bellenguez C, Freeman C, Hellenthal G, Giannoulatou E, Pirinen M, Pearson RD, Strange A, Su Z, Vukcevic D, Donnelly P, Langford C, Hunt SE, Edkins S, Gwilliam R, Blackburn H, Bumpstead SJ, Dronov S, Gillman M, Gray E, Hammond N, Jayakumar A, McCann OT, Liddle J, Potter SC, Ravindrarajah R, Ricketts M, Tashakkori-Ghanbaria A, Waller MJ, Weston P, Widaa S, Whittaker P, Barroso I, Deloukas P, Mathew CG, Blackwell JM, Brown MA, Corvin AP, McCarthy MI, Spencer CC, Bramon E, Corvin AP, O'Donovan MC, Stefansson K, Scolnick E, Purcell S, McCarroll SA, Sklar P, Hultman CM and Sullivan PF.
Journal Nat. Genet. 45 (10), 1150-1159 (2013)
Title Potential of dihydropyrimidine dehydrogenase genotypes in personalizing 5-fluorouracil therapy among colorectal cancer patients .
Author Teh LK, Hamzah S, Hashim H, Bannur Z, Zakaria ZA, Hasbullani Z, Shia JK, Fijeraid H, Md Nor A, Zailani M, Ramasamy P, Ngow H, Sood
Journal Ther Drug Monit 35 (5), 624-630 (2013)
Title Screening of dihydropyrimidine dehydrogenase genetic variants by direct sequencing in different ethnic groups .
Author Shin JG, Cheong HS, Kim JY, Kim LH, Han CS, Kim JO, Kim HD, Kim YH, Chung MW, Han SY and Shin HD.
Journal J. Korean Med. Sci. 28 (8), 1129-1133 (2013)
Title Molecular cloning and characterization of the human dihydropyrimidine dehydrogenase promoter .
Author Shestopal SA, Johnson MR and Diasio RB.
Journal Biochim. Biophys. Acta 1494 (1-2), 162-169 (2000)
Title Structural organization of the human dihydropyrimidine dehydrogenase gene .
Author Johnson MR, Wang K, Tillmanns S, Albin N and Diasio RB.
Journal Cancer Res. 57 (9), 1660-1663 (1997)
Title Purification and characterization of dihydropyrimidine dehydrogenase from human liver .
Author Lu ZH, Zhang R and Diasio RB.
Journal J. Biol. Chem. 267 (24), 17102-17109 (1992)
Title Mechanism-based inactivation of dihydropyrimidine dehydrogenase by 5-ethynyluracil .
Author Porter DJ, Chestnut WG, Merrill BM and Spector T.
Journal J. Biol. Chem. 267 (8), 5236-5242 (1992)
Title Dihydropyrimidine dehydrogenase activity in human blood mononuclear cells .
Author Tuchman M, Roemeling RV, Hrushesky WA, Sothern RB and O'Dea RF.
Journal Enzyme 42 (1), 15-24 (1989)
Title Familial deficiency of dihydropyrimidine dehydrogenase. Biochemical basis for familial pyrimidinemia and severe 5-fluorouracil-induced toxicity .
Author Diasio RB, Beavers TL and Carpenter JT.
Journal J. Clin. Invest. 81 (1), 47-51 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.