• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens solute carrier family 26, member 3 (SLC26A3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000111 Homo sapiens solute carrier family 26, member 3 (SLC26A3), mRNA. GenEZ ORF Cloning On-demand $849.00 20

*Business Day

Related Services

RefSeq Version NM_000111.2, 171543859
Length 2894 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens solute carrier family 26, member 3 (SLC26A3), mRNA.
Product chloride anion exchanger
Comment

Summary: The protein encoded by this gene is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea. [provided by RefSeq, Oct 2008].

RefSeq NP_000102.1
CDS 212..2506
Misc Feature(1)11
Misc Feature(2)11
Misc Feature(3)131..133
Misc Feature(4)131..133
Misc Feature(5)383..634
Misc Feature(6)383..634
Misc Feature(7)440..502
Misc Feature(8)509..571
Misc Feature(9)584..646
Misc Feature(10)737..799
Misc Feature(11)788..1624
Misc Feature(12)803..865
Misc Feature(13)986..1048
Misc Feature(14)1067..1129
Misc Feature(15)1238..1300
Misc Feature(16)1334..1396
Misc Feature(17)1445..1507
Misc Feature(18)1526..1588
Misc Feature(19)1619..1681
Misc Feature(20)1718..1720
Misc Feature(21)1736..1738
Misc Feature(22)1769..1771
Misc Feature(23)1787..>1966
Misc Feature(24)<2120..2347
Misc Feature(25)2141..2203
Misc Feature(26)2315..2377
Exon (1)1..123
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (2)124..342
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (3)343..482
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (4)483..593
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (5)594..781
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (6)782..946
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (7)947..1099
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (8)1100..1182
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (9)1183..1330
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (10)1331..1444
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (11)1445..1522
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (12)1523..1618
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (13)1619..1725
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (14)1726..1795
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (15)1796..1888
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (16)1889..1984
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (17)1985..2218
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (18)2219..2273
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (19)2274..2416
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (20)2417..2482
Gene:SLC26A3
Gene Synonym:CLD; DRA
Exon (21)2483..2894
Gene:SLC26A3
Gene Synonym:CLD; DRA
Translation MIEPFGNQYIVARPVYSTNAFEENHKKTGRHHKTFLDHLKVCCSCSPQKAKRIVLSLFPI ASWLPAYRLKEWLLSDIVSGISTGIVAVLQGLAFALLVDIPPVYGLYASFFPAIIYLFFG TSRHISVGPFPILSMMVGLAVSGAVSKAVPDRNATTLGLPNNSNNSSLLDDERVRVAAAA SVTVLSGIIQLAFGILRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFIFQLTVPSHTDP VSIFKVLYSVFSQIEKTNIADLVTALIVLLVVSIVKEINQRFKDKLPVPIPIEFIMTVIA AGVSYGCDFKNRFKVAVVGDMNPGFQPPITPDVETFQNTVGDCFGIAMVAFAVAFSVASV YSLKYDYPLDGNQELIALGLGNIVCGVFRGFAGSTALSRSAVQESTGGKTQIAGLIGAII VLIVVLAIGFLLAPLQKSVLAALALGNLKGMLMQFAEIGRLWRKDKYDCLIWIMTFIFTI VLGLGLGLAASVAFQLLTIVFRTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRC PSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDT IKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLD VSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHI LMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(172)-g, adbSNP:187600896
complement(245)-c, adbSNP:201803182
complement(259)-c, adbSNP:182526650
complement(315)-g, adbSNP:144627478
complement(330)-t, cdbSNP:78133952
complement(340)-g, adbSNP:199700484
complement(358)-dbSNP:
complement(358)-c, adbSNP:200940608
complement(414)-t, cdbSNP:10280704
complement(452)-t, cdbSNP:116793431
complement(460)-t, gdbSNP:201503990
complement(472)-t, gdbSNP:202020458
complement(506)-dbSNP:
complement(506)-t, cdbSNP:150004100
complement(543)-g, adbSNP:75733585
complement(568)-t, g, adbSNP:73419912
complement(582)-t, adbSNP:121913030
complement(589)-g, adbSNP:142349142
complement(590)-t, cdbSNP:142116047
complement(604)-dbSNP:
complement(604)-t, cdbSNP:140184294
complement(608)-g, adbSNP:146149806
complement(669)-t, cdbSNP:142400087
complement(725)-t, cdbSNP:71566741
complement(741)-g, adbSNP:147974764
complement(744)-g, adbSNP:143515876
complement(745)-t, cdbSNP:149275142
complement(770)-t, gdbSNP:121913032
complement(801)-dbSNP:
complement(801)-t, cdbSNP:201844799
complement(866)-c, adbSNP:138427715
complement(922)-g, cdbSNP:145962719
complement(952)-dbSNP:
complement(952)-t, cdbSNP:188437289
complement(1035)-g, adbSNP:142128989
complement(1127)-dbSNP:
complement(1127)-t, cdbSNP:138234173
complement(1132)-c, adbSNP:34407351
complement(1134)-t, cdbSNP:80222394
complement(1160..1162)-, gtgdbSNP:121913029
complement(1161)-c, adbSNP:78983942
complement(1206)-dbSNP:
complement(1206)-t, cdbSNP:140952086
complement(1207)-g, adbSNP:35576676
complement(1217)-c, adbSNP:142761906
complement(1237)-g, adbSNP:148961545
complement(1324)-g, adbSNP:146803737
complement(1399)-dbSNP:
complement(1399)-g, adbSNP:139145429
complement(1404)-g, adbSNP:143839547
complement(1425)-g, cdbSNP:199638708
complement(1468)-dbSNP:
complement(1468)-g, adbSNP:140126824
complement(1484)-t, cdbSNP:146161125
complement(1509)-g, adbSNP:200724013
complement(1510)-g, adbSNP:3735605
complement(1525)-dbSNP:
complement(1525)-g, adbSNP:117703371
complement(1526)-t, cdbSNP:183357373
complement(1597)-g, adbSNP:121913033
complement(1663)-dbSNP:
complement(1663)-g, adbSNP:200404042
complement(1706)-t, cdbSNP:150724234
complement(1720)-g, adbSNP:111750004
complement(1723)-t, cdbSNP:199870537
complement(1740)-dbSNP:
complement(1740)-g, adbSNP:60147601
complement(1783)-t, cdbSNP:148222595
complement(1830)-dbSNP:
complement(1830)-c, adbSNP:147164102
complement(1856)-t, cdbSNP:184317244
complement(1860)-g, cdbSNP:201414043
complement(1872)-t, cdbSNP:2301635
complement(1913)-dbSNP:
complement(1913)-g, cdbSNP:143677801
complement(1939)-g, cdbSNP:138094082
complement(1947)-t, cdbSNP:201969535
complement(1964)-t, cdbSNP:147019341
complement(1997)-dbSNP:
complement(1997)-c, adbSNP:201220816
complement(2012)-t, cdbSNP:201078396
complement(2013)-g, adbSNP:35776303
complement(2062)-t, gdbSNP:138629546
complement(2116)-g, adbSNP:202216109
complement(2148)-t, cdbSNP:200559868
complement(2164)-g, adbSNP:41669
complement(2165)-t, cdbSNP:140426439
complement(2236..2237)-dbSNP:
complement(2236..2237)-, atcdbSNP:121913031
complement(2249..2250)-, cdbSNP:35617203
complement(2254)-g, cdbSNP:143786154
complement(2261)-t, cdbSNP:199895223
complement(2262)-g, adbSNP:183775228
complement(2273)-g, cdbSNP:191547831
complement(2276)-dbSNP:
complement(2276)-c, adbSNP:146830301
complement(2278)-g, adbSNP:143670801
complement(2303)-g, cdbSNP:138002384
complement(2327)-t, adbSNP:146610949
complement(2380)-g, cdbSNP:142908255
complement(2386)-g, adbSNP:201137330
complement(2404)-g, adbSNP:148586598
complement(2465)-dbSNP:
complement(2465)-t, gdbSNP:144817916
complement(2469)-t, cdbSNP:35342296
complement(2619)-dbSNP:
complement(2619)-g, adbSNP:192893142
complement(2769)-g, cdbSNP:116732405
complement(2888)-g, cdbSNP:188158351
complement(2892)-t, cdbSNP:183578733
Gene SymbolSLC26A3
Gene SynonymCLD; DRA
Chromosome7
Locus Map7q31
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000111 Homo sapiens solute carrier family 26, member 3 (SLC26A3), mRNA. On-demand $849.00 20
Title Role of N-glycosylation in cell surface expression and protection against proteolysis of the intestinal anion exchanger SLC26A3 .
Author Hayashi,H. and Yamashita,Y.
Journal Am. J. Physiol., Cell Physiol. 302 (5), C781-C795 (2012)
Title Significance of molecular testing for congenital chloride diarrhea .
Author Lechner,S., Ruemmele,F.M., Zankl,A., Lausch,E., Huber,W.D., Mihatsch,W., Phillips,A.D., Lewindon,P., Querfeld,U., Heinz-Erian,P., Muller,T. and Janecke,A.R.
Journal J. Pediatr. Gastroenterol. Nutr. 53 (1), 48-54 (2011)
Title Update on SLC26A3 mutations in congenital chloride diarrhea .
Author Wedenoja,S., Pekansaari,E., Hoglund,P., Makela,S., Holmberg,C. and Kere,J.
Journal Hum. Mutat. 32 (7), 715-722 (2011)
Title Native and recombinant Slc26a3 (downregulated in adenoma, Dra) do not exhibit properties of 2Cl-/1HCO3- exchange .
Author Alper,S.L., Stewart,A.K., Vandorpe,D.H., Clark,J.S., Horack,R.Z., Simpson,J.E., Walker,N.M. and Clarke,L.L.
Journal Am. J. Physiol., Cell Physiol. 300 (2), C276-C286 (2011)
Title Compound heterozygous mutations in the SLC26A3 gene in 2 Spanish siblings with congenital chloride diarrhea .
Author Rodriguez-Herrera,A., Navas-Lopez,V.M., Redondo-Nevado,J. and Gutierrez,G.
Journal J. Pediatr. Gastroenterol. Nutr. 52 (1), 106-110 (2011)
Title Human DRA functions as a sulfate transporter in Sf9 insect cells .
Author Byeon,M.K., Frankel,A., Papas,T.S., Henderson,K.W. and Schweinfest,C.W.
Journal Protein Expr. Purif. 12 (1), 67-74 (1998)
Title Mutations of the Down-regulated in adenoma (DRA) gene cause congenital chloride diarrhoea .
Author Hoglund,P., Haila,S., Socha,J., Tomaszewski,L., Saarialho-Kere,U., Karjalainen-Lindsberg,M.L., Airola,K., Holmberg,C., de la Chapelle,A. and Kere,J.
Journal Nat. Genet. 14 (3), 316-319 (1996)
Title Localization of a candidate colon tumor-suppressor gene (DRA) to 7q22-q31.1 by fluorescence in situ hybridization .
Author Taguchi,T., Testa,J.R., Papas,T.S. and Schweinfest,C.
Journal Genomics 20 (1), 146-147 (1994)
Title Similarities between a soybean nodulin, Neurospora crassa sulphate permease II and a putative human tumour suppressor .
Author Sandal,N.N. and Marcker,K.A.
Journal Trends Biochem. Sci. 19 (1), 19 (1994)
Title Identification of a colon mucosa gene that is down-regulated in colon adenomas and adenocarcinomas .
Author Schweinfest,C.W., Henderson,K.W., Suster,S., Kondoh,N. and Papas,T.S.
Journal Proc. Natl. Acad. Sci. U.S.A. 90 (9), 4166-4170 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.