• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens erythropoietin receptor (EPOR), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu23230 Homo sapiens erythropoietin receptor (EPOR), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu23230C Homo sapiens erythropoietin receptor (EPOR), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000121.3, 296040523
Length 1527 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens erythropoietin receptor (EPOR), transcript variant 1, mRNA.
Product erythropoietin receptor precursor
Comment

Summary: This gene encodes the erythropoietin receptor which is a member of the cytokine receptor family. Upon erythropoietin binding, this receptor activates Jak2 tyrosine kinase which activates different intracellular pathways including: Ras/MAP kinase, phosphatidylinositol 3-kinase and STAT transcription factors. The stimulated erythropoietin receptor appears to have a role in erythroid cell survival. Defects in the erythropoietin receptor may produce erythroleukemia and familial erythrocytosis. Dysregulation of this gene may affect the growth of certain tumors. Alternate splicing results in multiple transcript variants.[provided by RefSeq, May 2010].


Transcript Variant: This variant (1) encodes the functional protein.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000112.1
CDS 136..1662
Misc Feature(1)58..60
Misc Feature(2)244..555
Misc Feature(3)484..486
Misc Feature(4)571..867
Misc Feature(5)order(769..771,829..831)
Misc Feature(6)832..846
Misc Feature(7)order(832..837,841..846)
Misc Feature(8)886..954
Misc Feature(9)979..1005
Misc Feature(10)1237..1239
Misc Feature(11)1237..1239
Misc Feature(12)1411..1413
Misc Feature(13)1411..1413
Misc Feature(14)1489..1506
Misc Feature(15)1495..1503
Misc Feature(16)1495..1497
Misc Feature(17)1495..1497
Misc Feature(18)1501..1503
Misc Feature(19)1501..1503
Misc Feature(20)1537..1539
Misc Feature(21)1588..1590
Misc Feature(22)1588..1590
Misc Feature(23)1600..1602
Misc Feature(24)1645..1647
Exon (1)1..250
Gene:EPOR
Gene Synonym:EPO-R
Exon (2)251..386
Gene:EPOR
Gene Synonym:EPO-R
Exon (3)387..562
Gene:EPOR
Gene Synonym:EPO-R
Exon (4)563..720
Gene:EPOR
Gene Synonym:EPO-R
Exon (5)721..874
Gene:EPOR
Gene Synonym:EPO-R
Exon (6)875..962
Gene:EPOR
Gene Synonym:EPO-R
Exon (7)963..1050
Gene:EPOR
Gene Synonym:EPO-R
Exon (8)1051..2441
Gene:EPOR
Gene Synonym:EPO-R
Translation MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL ELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRY EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV SLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG SEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL SDGPYSNPYENSLIPAAEPLPPSYVACS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(3)-dbSNP:
complement(3)-c, adbSNP:147119630
complement(13)-t, cdbSNP:316500
complement(81)-t, cdbSNP:140630699
complement(253)-dbSNP:
complement(253)-t, cdbSNP:367994954
complement(272)-t, cdbSNP:45516306
complement(303)-c, adbSNP:35977803
complement(352)-t, cdbSNP:374237735
complement(368)-g, cdbSNP:140267472
complement(379)-g, adbSNP:370865377
complement(384)-t, gdbSNP:151226066
complement(397)-dbSNP:
complement(397)-g, adbSNP:374025764
complement(431)-g, adbSNP:146235694
complement(444)-t, cdbSNP:370023439
complement(459)-t, cdbSNP:375735369
complement(470)-g, adbSNP:373833534
complement(474)-t, gdbSNP:376239211
complement(491)-g, cdbSNP:371029194
complement(508)-t, cdbSNP:377550572
complement(510)-t, cdbSNP:147573962
complement(530)-t, cdbSNP:376532680
complement(540)-c, adbSNP:201253733
complement(573)-dbSNP:
complement(573)-g, adbSNP:114645751
complement(588)-c, adbSNP:141262829
complement(638)-g, adbSNP:149831382
complement(693)-g, adbSNP:377322757
complement(703)-c, adbSNP:139849355
complement(730)-dbSNP:
complement(730)-g, adbSNP:369327794
complement(769)-c, adbSNP:185740642
complement(774)-g, cdbSNP:61729445
complement(792)-t, gdbSNP:61729384
complement(805)-t, cdbSNP:375609414
complement(873)-g, cdbSNP:200636512
complement(913)-dbSNP:
complement(913)-t, cdbSNP:373709817
complement(925)-g, cdbSNP:150695961
complement(926)-c, adbSNP:200458897
complement(936)-g, cdbSNP:142951311
complement(987)-dbSNP:
complement(987)-g, adbSNP:201953069
complement(995)-g, adbSNP:139756642
complement(996)-t, cdbSNP:369085901
complement(1009)-t, cdbSNP:200057444
complement(1048)-g, c, adbSNP:60825798
complement(1051)-dbSNP:
complement(1051)-g, cdbSNP:192923196
complement(1057)-g, adbSNP:371786811
complement(1120)-g, cdbSNP:201571204
complement(1140)-t, cdbSNP:146315075
complement(1159)-t, cdbSNP:368125452
complement(1175)-g, adbSNP:141940285
complement(1176)-t, cdbSNP:138884102
complement(1179)-t, cdbSNP:60476134
complement(1186)-g, cdbSNP:368363386
complement(1207)-g, adbSNP:183679845
1246+a, gdbSNP:35586415
complement(1262)-t, adbSNP:192441411
complement(1273)-g, cdbSNP:35423344
complement(1274)-g, adbSNP:199645071
1277..1278+, ccdbSNP:281860299
complement(1292..1293)-, gdbSNP:34486271
complement(1367)-g, adbSNP:370515840
complement(1368)-t, gdbSNP:149300172
1370+a, c, tdbSNP:281860298
complement(1371)-t, cdbSNP:373647199
1413+c, gdbSNP:121917831
complement(1438)-g, cdbSNP:138559043
complement(1445)-t, cdbSNP:62638744
1446..1447+, tcdbSNP:281860297
complement(1449)-t, cdbSNP:200974642
1451+a, gdbSNP:121917830
1452+a, gdbSNP:121918116
complement(1472)-g, adbSNP:202047325
complement(1476)-g, adbSNP:140903357
complement(1500)-t, cdbSNP:202041743
complement(1509)-c, adbSNP:187931104
complement(1525)-t, adbSNP:370541202
complement(1528)-c, adbSNP:376951711
complement(1533)-g, adbSNP:138190746
complement(1542)-g, adbSNP:199637505
complement(1562)-g, adbSNP:146937816
complement(1563)-g, adbSNP:141096553
complement(1574)-g, adbSNP:199509853
complement(1591)-g, adbSNP:370841243
complement(1597)-g, adbSNP:142094773
complement(1605)-g, cdbSNP:377657947
complement(1623)-g, adbSNP:149193129
complement(1625)-g, adbSNP:375280404
complement(1636)-g, adbSNP:369228469
complement(1640)-t, g, cdbSNP:200372382
complement(1667)-g, adbSNP:112348054
complement(1690)-t, gdbSNP:182850257
complement(1691)-g, adbSNP:367583626
complement(1694)-g, adbSNP:199784763
complement(1697)-t, cdbSNP:200997864
complement(1768)-t, cdbSNP:147359717
complement(1770)-c, adbSNP:369251866
complement(1850)-t, gdbSNP:200554588
complement(1856)-t, gdbSNP:142688979
complement(1856)-c, adbSNP:386474623
complement(1867..1868)-, tadbSNP:374474693
complement(1939)-t, adbSNP:191481987
complement(2059)-t, cdbSNP:185249501
2087+a, gdbSNP:140441486
2166+c, tdbSNP:150535617
2239+c, tdbSNP:141524122
complement(2325)-g, cdbSNP:148340466
complement(2339)-g, cdbSNP:376736196
complement(2399)-t, cdbSNP:143402071
Gene SymbolEPOR
Gene SynonymEPO-R
Chromosome19
Locus Map19p13.3-p13.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000121 Homo sapiens erythropoietin receptor (EPOR), transcript variant 1, mRNA. In-stock $99.00 5-7
Title EPO-independent functional EPO receptor in breast cancer enhances estrogen receptor activity and promotes cell proliferation .
Author Reinbothe S, Larsson AM, Vaapil M, Wigerup C, Sun J, Jogi A, Neumann D, Ronnstrand L and Pahlman S.
Journal Biochem. Biophys. Res. Commun. 445 (1), 163-169 (2014)
Title In vivo knockdown of adipocyte erythropoietin receptor does not alter glucose or energy homeostasis .
Author Luk CT, Shi SY, Choi D, Cai EP, Schroer SA and Woo M.
Journal Endocrinology 154 (10), 3652-3659 (2013)
Title Erythropoietin is involved in the angiogenic potential of bone marrow macrophages in multiple myeloma .
Author De Luisi A, Binetti L, Ria R, Ruggieri S, Berardi S, Catacchio I, Racanelli V, Pavone V, Rossini B, Vacca A and Ribatti D.
Journal Angiogenesis 16 (4), 963-973 (2013)
Title Changes in the Expression of Transcription Factors Involved in Modulating the Expression of EPO-R in Activated Human CD4-Positive Lymphocytes .
Author Lisowska KA, Frackowiak JE, Mikosik A and Witkowski JM.
Journal PLoS ONE 8 (4), E60326 (2013)
Title A truncated erythropoietin receptor that fails to prevent programmed cell death of erythroid cells .
Author Nakamura Y, Komatsu N and Nakauchi H.
Journal Science 257 (5073), 1138-1141 (1992)
Title In vitro phosphorylation of the erythropoietin receptor and an associated protein, pp130 .
Author Yoshimura A and Lodish HF.
Journal Mol. Cell. Biol. 12 (2), 706-715 (1992)
Title Genomic organization of the human erythropoietin receptor gene .
Author Penny LA and Forget BG.
Journal Genomics 11 (4), 974-980 (1991)
Title Cloning of the gene encoding the human erythropoietin receptor .
Author Maouche L, Tournamille C, Hattab C, Boffa G, Cartron JP and Chretien S.
Journal Blood 78 (10), 2557-2563 (1991)
Title The erythropoietin receptor gene: cloning and identification of multiple transcripts in an erythroid cell line OCIM1 .
Author Ehrenman K and St John T.
Journal Exp. Hematol. 19 (9), 973-977 (1991)
Title Human erythropoietin receptor: cloning, expression, and biologic characterization .
Author Jones SS, D'Andrea AD, Haines LL and Wong GG.
Journal Blood 76 (1), 31-35 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.