• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 3 (ERCC3), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000122 Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 3 (ERCC3), mRNA. GenEZ ORF Cloning On-demand $899.00 20

*Business Day

Related Services

RefSeq Version NM_000122.1, 4557562
Length 2751 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 3 (ERCC3), mRNA.
Product TFIIH basal transcription factor complex helicase XPB subunit
Comment

Summary: ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription. [provided by RefSeq, Jul 2008].

RefSeq NP_000113.1
CDS 96..2444
Misc Feature(1)15..17
Misc Feature(2)15..17
Misc Feature(3)41
Misc Feature(4)111..149
Misc Feature(5)111..149
Misc Feature(6)273..2432
Misc Feature(7)318..695
Misc Feature(8)1095..1505
Misc Feature(9)1122..1136
Misc Feature(10)1203..1205
Misc Feature(11)1416..1427
Misc Feature(12)1416..1427
Misc Feature(13)1692..2039
Misc Feature(14)order(1782..1793,1836..1841,1917..1925)
Misc Feature(15)order(1941..1943,2007..2009,2019..2021,2028..2030)
Misc Feature(16)2346..2348
Exon (1)1..123
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (2)124..329
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (3)330..566
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (4)567..616
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (5)617..752
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (6)753..917
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (7)918..1122
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (8)1123..1437
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (9)1438..1622
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (10)1623..1825
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (11)1826..1922
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (12)1923..2040
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (13)2041..2159
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (14)2160..2312
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (15)2313..2750
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Translation MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD YRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESC HPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKR CLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNK FRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFY SLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRF RK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(27)-t, cdbSNP:9282675
complement(28)-g, adbSNP:112044862
complement(77)-g, adbSNP:184301749
complement(127)-dbSNP:
complement(127)-t, cdbSNP:199934696
complement(174)-t, cdbSNP:144596821
complement(239)-g, cdbSNP:149309991
complement(326)-c, adbSNP:201635630
complement(359)-dbSNP:
complement(359)-g, adbSNP:147181852
complement(374)-g, adbSNP:146938627
complement(391)-t, cdbSNP:121913045
complement(409)-t, cdbSNP:116713511
complement(410)-t, cdbSNP:201698871
complement(420)-g, adbSNP:34295337
complement(445)-g, adbSNP:1805161
complement(450)-c, adbSNP:121913046
complement(480)-t, cdbSNP:145762413
complement(497)-g, adbSNP:116248040
complement(532)-g, adbSNP:149781954
complement(623)-dbSNP:
complement(623)-g, adbSNP:114994654
complement(624)-t, cdbSNP:139690693
complement(645)-t, cdbSNP:140572401
complement(671)-g, adbSNP:145214879
complement(672)-t, cdbSNP:144491407
complement(678)-g, cdbSNP:138385061
complement(710)-t, cdbSNP:13427563
complement(713)-g, adbSNP:145830873
complement(789)-dbSNP:
complement(789)-t, cdbSNP:201383161
complement(809)-t, cdbSNP:143290830
complement(900)-t, adbSNP:201622885
complement(921)-dbSNP:
complement(921)-t, adbSNP:200443230
complement(942)-g, adbSNP:145201970
complement(972)-t, cdbSNP:142304812
complement(985)-g, adbSNP:145267069
complement(1025)-t, cdbSNP:150759935
complement(1088)-t, cdbSNP:148629399
complement(1099)-g, adbSNP:142333442
complement(1103)-t, cdbSNP:115924997
complement(1122)-t, cdbSNP:138897577
complement(1211)-dbSNP:
complement(1211)-t, cdbSNP:141001550
complement(1214)-g, adbSNP:2228544
complement(1254)-t, adbSNP:147653814
complement(1267)-t, cdbSNP:201840181
complement(1296)-t, cdbSNP:115176021
complement(1299)-t, g, adbSNP:1805162
complement(1340)-g, adbSNP:141399407
complement(1365)-t, cdbSNP:200098409
complement(1368)-t, cdbSNP:121913047
complement(1430)-t, cdbSNP:4150422
complement(1441)-dbSNP:
complement(1441)-t, cdbSNP:115481013
complement(1443)-t, cdbSNP:200291162
complement(1449)-g, adbSNP:150954655
complement(1457)-t, cdbSNP:201619590
complement(1498)-g, adbSNP:144012336
complement(1505)-g, adbSNP:199795595
complement(1517)-g, adbSNP:114726976
complement(1580)-g, adbSNP:4150456
complement(1653)-dbSNP:
complement(1653)-g, cdbSNP:148789293
complement(1728)-t, cdbSNP:121913048
complement(1829)-dbSNP:
complement(1829)-g, adbSNP:149610846
complement(1835)-g, adbSNP:13428173
complement(1838)-g, adbSNP:147061557
complement(1936)-dbSNP:
complement(1936)-g, adbSNP:139049289
complement(2049)-dbSNP:
complement(2049)-c, adbSNP:201793642
complement(2096)-t, gdbSNP:182713248
complement(2123)-g, adbSNP:41553418
complement(2175)-dbSNP:
complement(2175)-t, c, adbSNP:151216904
complement(2182)-c, adbSNP:201806429
complement(2201)-t, cdbSNP:114508982
complement(2206)-t, cdbSNP:4150521
complement(2207)-t, c, adbSNP:114710997
complement(2240)-t, cdbSNP:199906409
complement(2276)-t, cdbSNP:199818181
complement(2277)-t, cdbSNP:143140054
complement(2298)-t, cdbSNP:4150522
complement(2334)-t, cdbSNP:140023882
complement(2358)-t, cdbSNP:115312738
complement(2375)-c, adbSNP:141971239
complement(2386)-g, adbSNP:189511674
complement(2419)-g, adbSNP:114613120
complement(2429)-t, cdbSNP:147499527
complement(2431)-t, cdbSNP:146427260
complement(2436)-t, cdbSNP:200411611
complement(2463)-g, adbSNP:202107588
complement(2473)-t, cdbSNP:4150523
complement(2550)-t, cdbSNP:4150524
complement(2621)-g, adbSNP:4150525
complement(2666)-c, adbSNP:55967313
complement(2668)-g, adbSNP:192914113
complement(2703)-g, adbSNP:1803541
Gene SymbolERCC3
Gene SynonymBTF2; GTF2H; RAD25; TFIIH; XPB
Chromosome2
Locus Map2q21
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000122 Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 3 (ERCC3), mRNA. On-demand $899.00 20
Title ARCH domain of XPD, an anchoring platform for CAK that conditions .
Author Abdulrahman,W., Iltis,I., Radu,L., Braun,C., Maglott-Roth,A., Giraudon,C., Egly,J.M. and Poterszman,A.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (8), E633-E642 (2013)
Title Lack of CAK complex accumulation at DNA damage sites in XP-B and XP-B/CS fibroblasts reveals differential regulation of CAK anchoring to core TFIIH by XPB and XPD helicases during nucleotide excision repair .
Author Zhu,Q., Wani,G., Sharma,N. and Wani,A.
Journal DNA Repair (Amst.) 11 (12), 942-950 (2012)
Title Phenotype-specific adverse effects of XPD mutations on human prenatal development implicate impairment of TFIIH-mediated functions in placenta .
Author Moslehi,R., Kumar,A., Mills,J.L., Ambroggio,X., Signore,C. and Dzutsev,A.
Journal Eur. J. Hum. Genet. 20 (6), 626-631 (2012)
Title Correlations among ERCC1, XPB, UBE2I, EGF, TAL2 and ILF3 revealed by gene signatures of histological subtypes of patients with epithelial ovarian cancer .
Author Guo,Y., Fu,P., Zhu,H., Reed,E., Remick,S.C., Petros,W., Mueller,M.D. and Yu,J.J.
Journal Oncol. Rep. 27 (1), 286-292 (2012)
Title Deficiency in nucleotide excision repair family gene activity, especially ERCC3, is associated with non-pigmented hair fiber growth .
Author Yu,M., Bell,R.H., Ho,M.M., Leung,G., Haegert,A., Carr,N., Shapiro,J. and McElwee,K.J.
Journal PLoS ONE 7 (5), E34185 (2012)
Title Molecular and functional analysis of the XPBC/ERCC-3 promoter: transcription activity is dependent on the integrity of an Sp1-binding site .
Author Ma,L., Weeda,G., Jochemsen,A.G., Bootsma,D., Hoeijmakers,J.H. and van der Eb,A.J.
Journal Nucleic Acids Res. 20 (2), 217-224 (1992)
Title Structure and expression of the human XPBC/ERCC-3 gene involved in .
Author Weeda,G., Ma,L.B., van Ham,R.C., van der Eb,A.J. and Hoeijmakers,J.H.
Journal Nucleic Acids Res. 19 (22), 6301-6308 (1991)
Title Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter .
Author Jacob,G.A., Luse,S.W. and Luse,D.S.
Journal J. Biol. Chem. 266 (33), 22537-22544 (1991)
Title Localization of the xeroderma pigmentosum group B-correcting gene ERCC3 to human chromosome 2q21 .
Author Weeda,G., Wiegant,J., van der Ploeg,M., Geurts van Kessel,A.H., van der Eb,A.J. and Hoeijmakers,J.H.
Journal Genomics 10 (4), 1035-1040 (1991)
Title Molecular cloning and biological characterization of the human excision repair gene ERCC-3 .
Author Weeda,G., van Ham,R.C., Masurel,R., Westerveld,A., Odijk,H., de Wit,J., Bootsma,D., van der Eb,A.J. and Hoeijmakers,J.H.
Journal Mol. Cell. Biol. 10 (6), 2570-2581 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.