• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens excision repair cross-complementation group 3 (ERCC3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25443 Homo sapiens excision repair cross-complementation group 3 (ERCC3), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu25443C Homo sapiens excision repair cross-complementation group 3 (ERCC3), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000122.1, 4557562
Length 2349 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens excision repair cross-complementation group 3 (ERCC3), mRNA.
Product TFIIH basal transcription factor complex helicase XPB subunit
Comment

Summary: ERCC3 is an ATP-dependent DNA helicase that functions in nucleotide excision repair and complements xeroderma pigmentosum group B mutations. It also is the 89 kDa subunit of basal transcription factor 2 (TFIIH) and thus functions in class II transcription. [provided by RefSeq, Jul 2008].

RefSeq NP_000113.1
CDS 96..2444
Misc Feature(1)15..17
Misc Feature(2)15..17
Misc Feature(3)41
Misc Feature(4)111..149
Misc Feature(5)111..149
Misc Feature(6)273..2432
Misc Feature(7)318..695
Misc Feature(8)1095..1505
Misc Feature(9)1122..1136
Misc Feature(10)1203..1205
Misc Feature(11)1416..1427
Misc Feature(12)1416..1427
Misc Feature(13)1704..2033
Misc Feature(14)order(1782..1793,1836..1841,1917..1925)
Misc Feature(15)order(1941..1943,2007..2009,2019..2021,2028..2030)
Misc Feature(16)2346..2348
Exon (1)1..123
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (2)124..329
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (3)330..566
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (4)567..616
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (5)617..752
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (6)753..917
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (7)918..1122
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (8)1123..1437
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (9)1438..1622
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (10)1623..1825
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (11)1826..1922
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (12)1923..2040
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (13)2041..2159
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (14)2160..2312
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Exon (15)2313..2750
Gene:ERCC3
Gene Synonym:BTF2; GTF2H; RAD25; TFIIH; XPB
Translation MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESGTKVDEYGAKD YRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTA YSLYAAVSVGLQTSDITEYLRKLSKTGVPDGIMQFIKLCTVSYGKVKLVLKHNRYFVESC HPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQG KSDIPMDLFDFYEQMDKDEEEEEETQTVSFEVKQEMIEELQKRCIHLEYPLLAEYDFRND SVNPDINIDLKPTAVLRPYQEKSLRKMFGNGRARSGVIVLPCGAGKSLVGVTAACTVRKR CLVLGNSAVSVEQWKAQFKMWSTIDDSQICRFTSDAKDKPIGCSVAISTYSMLGHTTKRS WEAERVMEWLKTQEWGLMILDEVHTIPAKMFRRVLTIVQAHCKLGLTATLVREDDKIVDL NFLIGPKLYEANWMELQNNGYIAKVQCAEVWCPMSPEFYREYVAIKTKKRILLYTMNPNK FRACQFLIKFHERRNDKIIVFADNVFALKEYAIRLNKPYIYGPTSQGERMQILQNFKHNP KINTIFISKVGDTSFDLPEANVLIQISSHGGSRRQEAQRLGRVLRAKKGMVAEEYNAFFY SLVSQDTQEMAYSTKRQRFLVDQGYSFKVITKLAGMEEEDLAFSTKEEQQQLLQKVLAAT DLDAEEEVVAGEFGSRSSQASRRFGTMSSMSGADDTVYMEYHSSRSKAPSKHVHPLFKRF RK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(27)-t, cdbSNP:9282675
complement(28)-g, adbSNP:112044862
complement(45)-t, cdbSNP:374369052
complement(60)-g, cdbSNP:373118547
complement(62)-t, cdbSNP:369345469
complement(77)-g, adbSNP:184301749
complement(101)-g, cdbSNP:372673600
complement(127)-dbSNP:
complement(127)-t, cdbSNP:199934696
complement(174)-t, cdbSNP:144596821
complement(215)-t, cdbSNP:377744427
complement(221)-t, cdbSNP:375212335
complement(239)-g, cdbSNP:149309991
complement(281)-t, cdbSNP:370486531
complement(306)-g, adbSNP:377255867
complement(311)-g, adbSNP:373677438
complement(326)-c, adbSNP:201635630
complement(374)-dbSNP:
complement(374)-g, adbSNP:146938627
391+c, tdbSNP:121913045
complement(409)-t, cdbSNP:116713511
complement(410)-t, cdbSNP:201698871
complement(420)-g, adbSNP:34295337
445+a, gdbSNP:1805161
450+a, cdbSNP:121913046
complement(454)-g, adbSNP:370115857
complement(480)-t, cdbSNP:145762413
complement(497)-g, adbSNP:116248040
complement(532)-g, adbSNP:149781954
complement(556)-t, cdbSNP:376722014
complement(583)-dbSNP:
complement(583)-t, cdbSNP:376925542
complement(623)-dbSNP:
complement(623)-g, adbSNP:114994654
complement(624)-t, cdbSNP:139690693
complement(641)-g, adbSNP:372605490
complement(645)-t, cdbSNP:140572401
complement(672)-t, cdbSNP:144491407
complement(678)-g, cdbSNP:138385061
complement(710)-t, cdbSNP:13427563
complement(713)-g, adbSNP:145830873
complement(715)-g, cdbSNP:368953792
complement(750)-t, cdbSNP:374275821
complement(754)-dbSNP:
complement(754)-c, adbSNP:377665046
complement(789)-t, cdbSNP:201383161
complement(809)-t, cdbSNP:143290830
complement(836)-g, adbSNP:373495484
complement(900)-t, adbSNP:201622885
complement(921)-dbSNP:
complement(921)-t, adbSNP:200443230
complement(942)-g, adbSNP:145201970
complement(972)-t, cdbSNP:142304812
complement(985)-g, adbSNP:145267069
complement(988)-t, cdbSNP:369840433
complement(1022)-g, adbSNP:376640712
complement(1025)-t, cdbSNP:150759935
complement(1057)-t, cdbSNP:267598859
complement(1068)-g, adbSNP:368191279
complement(1088)-t, cdbSNP:148629399
complement(1099)-g, adbSNP:142333442
complement(1100)-t, cdbSNP:375184289
complement(1103)-t, cdbSNP:115924997
complement(1122)-t, cdbSNP:138897577
complement(1144)-dbSNP:
complement(1144)-c, adbSNP:374654628
complement(1148)-g, cdbSNP:373666495
complement(1171)-t, cdbSNP:370519739
complement(1191)-t, cdbSNP:375440546
complement(1206)-g, cdbSNP:371109024
complement(1211)-t, cdbSNP:141001550
complement(1214)-g, adbSNP:2228544
complement(1250)-g, adbSNP:371396764
complement(1251)-t, cdbSNP:374264195
complement(1254)-t, adbSNP:147653814
complement(1258)-t, cdbSNP:370645943
complement(1267)-t, cdbSNP:201840181
complement(1277)-g, adbSNP:377391723
complement(1296)-t, cdbSNP:115176021
1299+a, g, tdbSNP:1805162
complement(1307)-g, adbSNP:377591864
complement(1308)-t, cdbSNP:373790042
complement(1340)-g, adbSNP:141399407
complement(1365)-t, cdbSNP:200098409
1368+c, tdbSNP:121913047
complement(1430)-t, cdbSNP:4150422
complement(1441)-dbSNP:
complement(1441)-t, cdbSNP:115481013
complement(1443)-t, cdbSNP:200291162
complement(1449)-g, adbSNP:150954655
complement(1457)-t, cdbSNP:201619590
complement(1498)-g, adbSNP:144012336
complement(1505)-g, adbSNP:199795595
complement(1506)-t, cdbSNP:371627165
complement(1517)-g, adbSNP:114726976
complement(1546)-g, adbSNP:371767613
complement(1563)-t, cdbSNP:367552856
complement(1580)-g, adbSNP:4150456
complement(1588)-t, cdbSNP:373703862
complement(1653)-dbSNP:
complement(1653)-g, cdbSNP:148789293
complement(1678)-t, cdbSNP:377662408
1728+c, tdbSNP:121913048
complement(1752)-t, gdbSNP:368563699
complement(1816)-t, cdbSNP:373218532
complement(1835)-dbSNP:
complement(1835)-g, adbSNP:13428173
complement(1838)-g, adbSNP:147061557
complement(1933)-dbSNP:
complement(1933)-g, cdbSNP:373484527
complement(1936)-g, adbSNP:139049289
complement(2015)-t, cdbSNP:369447216
complement(2024)-c, adbSNP:375556869
complement(2049)-dbSNP:
complement(2049)-c, adbSNP:201793642
complement(2057)-g, cdbSNP:375848554
complement(2070)-c, adbSNP:368498162
complement(2096)-t, gdbSNP:182713248
complement(2113)-g, adbSNP:375990467
2123+a, gdbSNP:41553418
complement(2175)-dbSNP:
complement(2175)-t, c, adbSNP:151216904
complement(2182)-c, adbSNP:201806429
complement(2184)-t, cdbSNP:374262917
complement(2201)-t, cdbSNP:114508982
complement(2206)-t, cdbSNP:4150521
complement(2207)-t, c, adbSNP:114710997
complement(2239)-t, cdbSNP:377323636
complement(2240)-t, cdbSNP:199906409
complement(2276)-t, cdbSNP:199818181
complement(2277)-t, cdbSNP:143140054
complement(2298)-t, cdbSNP:4150522
complement(2298)-g, adbSNP:386591592
complement(2319)-dbSNP:
complement(2319)-g, adbSNP:368664230
complement(2321)-t, cdbSNP:376593226
complement(2334)-t, cdbSNP:140023882
complement(2343)-t, gdbSNP:369468852
complement(2358)-t, cdbSNP:115312738
complement(2375)-c, adbSNP:141971239
complement(2386)-g, adbSNP:189511674
complement(2398)-g, cdbSNP:372094432
complement(2419)-g, adbSNP:114613120
complement(2429)-t, cdbSNP:147499527
complement(2431)-t, cdbSNP:146427260
complement(2436)-t, cdbSNP:200411611
complement(2463)-g, adbSNP:202107588
complement(2473)-t, cdbSNP:4150523
complement(2473)-g, adbSNP:386591593
complement(2550)-t, cdbSNP:4150524
complement(2621)-g, adbSNP:4150525
complement(2666)-c, adbSNP:55967313
complement(2668)-g, adbSNP:192914113
complement(2703)-g, adbSNP:1803541
Gene SymbolERCC3
Gene SynonymBTF2; GTF2H; RAD25; TFIIH; XPB
Chromosome2
Locus Map2q21
Title G quadruplexes are genomewide targets of transcriptional helicases .
Author Gray LT, Vallur AC, Eddy J and Maizels N.
Journal Nat. Chem. Biol. 10 (4), 313-318 (2014)
Title Microsomal epoxide hydrolase (EPHX1) polymorphisms are associated with aberrant promoter methylation of ERCC3 and hematotoxicity in benzene-exposed workers .
Author Xing C, Chen Q, Li G, Zhang L, Zheng M, Zou Z, Hou L, Wang QF, Liu
Journal Environ. Mol. Mutagen. 54 (6), 397-405 (2013)
Title ARCH domain of XPD, an anchoring platform for CAK that conditions .
Author Abdulrahman W, Iltis I, Radu L, Braun C, Maglott-Roth A, Giraudon C, Egly JM and Poterszman A.
Journal Proc. Natl. Acad. Sci. U.S.A. 110 (8), E633-E642 (2013)
Title Structure of the C-terminal half of human XPB helicase and the impact of the disease-causing mutation XP11BE .
Author Hilario E, Li Y, Nobumori Y, Liu X and Fan L.
Journal Acta Crystallogr. D Biol. Crystallogr. 69 (PT 2), 237-246 (2013)
Title Lack of CAK complex accumulation at DNA damage sites in XP-B and XP-B/CS fibroblasts reveals differential regulation of CAK anchoring to core TFIIH by XPB and XPD helicases during nucleotide excision repair .
Author Zhu Q, Wani G, Sharma N and Wani A.
Journal DNA Repair (Amst.) 11 (12), 942-950 (2012)
Title Xeroderma Pigmentosum .
Author Kraemer,K.H. and DiGiovanna,J.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Molecular and functional analysis of the XPBC/ERCC-3 promoter: transcription activity is dependent on the integrity of an Sp1-binding site .
Author Ma L, Weeda G, Jochemsen AG, Bootsma D, Hoeijmakers JH and van der Eb AJ.
Journal Nucleic Acids Res. 20 (2), 217-224 (1992)
Title Structure and expression of the human XPBC/ERCC-3 gene involved in .
Author Weeda G, Ma LB, van Ham RC, van der Eb AJ and Hoeijmakers JH.
Journal Nucleic Acids Res. 19 (22), 6301-6308 (1991)
Title Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter .
Author Jacob GA, Luse SW and Luse DS.
Journal J. Biol. Chem. 266 (33), 22537-22544 (1991)
Title Localization of the xeroderma pigmentosum group B-correcting gene ERCC3 to human chromosome 2q21 .
Author Weeda G, Wiegant J, van der Ploeg M, Geurts van Kessel AH, van der Eb AJ and Hoeijmakers JH.
Journal Genomics 10 (4), 1035-1040 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.