• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens excision repair cross-complementation group 5 (ERCC5), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20331 Homo sapiens excision repair cross-complementation group 5 (ERCC5), mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu20331C Homo sapiens excision repair cross-complementation group 5 (ERCC5), mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000123.3, 324715039
Length 3561 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens excision repair cross-complementation group 5 (ERCC5), mRNA.
Product DNA repair protein complementing XP-G cells
Comment

Summary: This gene encodes a single-strand specific DNA endonuclease that makes the 3' incision in DNA excision repair following UV-induced damage. The protein may also function in other cellular processes, including RNA polymerase II transcription, and transcription-coupled DNA repair. Mutations in this gene cause xeroderma pigmentosum complementation group G (XP-G), which is also referred to as xeroderma pigmentosum VII (XP7), a skin disorder characterized by hypersensitivity to UV light and increased susceptibility for skin cancer development following UV exposure. Some patients also develop Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Read-through transcription exists between this gene and the neighboring upstream BIVM (basic, immunoglobulin-like variable motif containing) gene. [provided by RefSeq, Feb 2011].

RefSeq NP_000114.2
CDS 427..3987
Misc Feature(1)382..384
Misc Feature(2)427..3513
Misc Feature(3)427..3513
Misc Feature(4)427..>816
Misc Feature(5)427..711
Misc Feature(6)448..450
Misc Feature(7)order(514..516,655..657)
Misc Feature(8)order(670..768,787..798,799..816)
Misc Feature(9)892..894
Misc Feature(10)895..897
Misc Feature(11)1438..1440
Misc Feature(12)1447..1449
Misc Feature(13)1489..1491
Misc Feature(14)1492..1494
Misc Feature(15)1495..1497
Misc Feature(16)1576..1578
Misc Feature(17)1576..1578
Misc Feature(18)1708..1710
Misc Feature(19)2002..2004
Misc Feature(20)2002..2004
Misc Feature(21)2098..2100
Misc Feature(22)2101..2103
Misc Feature(23)2110..2112
Misc Feature(24)2113..2115
Misc Feature(25)2113..2115
Misc Feature(26)2596..2598
Misc Feature(27)<2674..3372
Misc Feature(28)2683..3069
Misc Feature(29)order(2791..2793,2797..2799,2854..2856,2860..2862)
Misc Feature(30)order(2791..2793,2797..2799)
Misc Feature(31)order(2854..2856,2860..2862)
Misc Feature(32)2971..3255
Misc Feature(33)order(2998..3015,3019..3036,3040..3051)
Misc Feature(34)3007..3009
Misc Feature(35)3367..3453
Misc Feature(36)3595..3645
Exon (1)1..514
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (2)515..690
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (3)691..806
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (4)807..893
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (5)894..954
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (6)955..1098
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (7)1099..1306
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (8)1307..2380
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (9)2381..2625
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (10)2626..2745
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (11)2746..2959
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (12)2960..3104
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (13)3105..3305
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (14)3306..3390
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (15)3391..4085
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Translation MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFH RLCKLLFFRIRPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIK TAFRSKRDEALPSLTQVRRENDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFF HNPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQYQLKGLLKK NYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTV AEVDSESLPSSSKMHGMSFDVKSSPCEKLKTEKEPDATPPSPRTLLAMQAALLGSSSEEE LESENRRQARGRNAPAAVDEGSISPRTLSAIKRALDDDEDVKVCAGDDVQTGGPGAEEMR INSSTENSDEGLKVRDGKGIPFTATLASSSVNSAEEHVASTNEGREPTDSVPKEQMSLVH VGTEAFPISDESMIKDRKDRLPLESAVVRHSDAPGLPNGRELTPASPTCTNSVSKNETHA EVLEQQNELCPYESKFDSSLLSSDDETKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNV ENVVSFNAKEHENFLETIQEQQTTESAGQDLISIPKAVEPMEIDSEESESDGSFIEVQSV ISDEELQAEFPETSKPPSEQGEEELVGTREGEAPAESESLLRDNSERDDVDGEPQEAEKD AEDSLHEWQDINLEELETLESNLLAQQNSLKAQKQQQERIAATVTGQMFLESQELLRLFG IPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDF HNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQ KNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIRE FCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVT CMLRKEKEAAASEIEAVSVAMEKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKR KNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKN GGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(8)-dbSNP:
complement(8)-t, cdbSNP:751402
185+c, tdbSNP:2296147
186+c, gdbSNP:4150249
227+c, gdbSNP:76752300
233..234+, agdbSNP:376399495
235..236+, agdbSNP:4150250
247+g, tdbSNP:151199206
265+g, tdbSNP:111985238
290+a, gdbSNP:112658526
353+a, gdbSNP:3218736
355+c, tdbSNP:2296148
364+a, tdbSNP:184274263
404+c, tdbSNP:376962813
443+c, tdbSNP:113590348
474+a, gdbSNP:202038276
480+c, tdbSNP:201240143
482+c, tdbSNP:34291397
489+a, gdbSNP:200464030
502+a, gdbSNP:371937705
509+a, cdbSNP:267607281
528+dbSNP:
528+g, tdbSNP:373207563
560+a, gdbSNP:140917545
564+c, tdbSNP:1047768
580+a, gdbSNP:141212999
641+a, cdbSNP:121434574
711+dbSNP:
711+a, gdbSNP:372298533
719+a, cdbSNP:375404851
723+c, tdbSNP:199515913
729+c, gdbSNP:150741329
738+a, gdbSNP:139161934
742+a, gdbSNP:367738239
802+a, cdbSNP:77569659
804+a, gdbSNP:147181939
818+dbSNP:
818+c, tdbSNP:376907700
832+c, tdbSNP:121434577
838+c, tdbSNP:188898060
849+c, tdbSNP:140613269
855+c, gdbSNP:4140390
859+a, gdbSNP:4987063
918+dbSNP:
918+a, gdbSNP:369013428
926..927+, cdbSNP:36034203
926+a, gdbSNP:59731086
936+c, tdbSNP:142884592
952+c, tdbSNP:121434573
968+dbSNP:
968+a, gdbSNP:4150295
980+c, tdbSNP:151061520
981+a, gdbSNP:374538522
996+c, tdbSNP:376691349
1002+c, tdbSNP:376756832
1018+c, gdbSNP:141369732
1066+c, tdbSNP:56255799
1067+a, gdbSNP:146833751
1092+a, gdbSNP:140730525
1133+dbSNP:
1133+c, gdbSNP:201777503
1142+a, tdbSNP:368469983
1151+a, gdbSNP:150473997
1165+a, gdbSNP:200504271
1186+a, gdbSNP:1047769
1193+a, gdbSNP:4150313
1198+c, tdbSNP:143523137
1213+c, tdbSNP:121434572
1214+a, gdbSNP:61749896
1235+a, gdbSNP:183202756
1237+g, tdbSNP:187564382
1241+c, tdbSNP:41545721
1251+a, gdbSNP:371780084
1252+a, gdbSNP:371712326
1302+a, gdbSNP:193097418
1310+dbSNP:
1310+c, tdbSNP:112571039
1358+c, gdbSNP:2307491
1371+c, tdbSNP:34061299
1372+a, gdbSNP:370453700
1386+c, tdbSNP:4150314
1397+c, tdbSNP:369001697
1450+a, cdbSNP:372910916
1456+a, gdbSNP:142927249
1467+c, tdbSNP:116926104
1503+a, gdbSNP:377130941
1520+a, gdbSNP:201200441
1534+c, tdbSNP:372636507
1535+a, gdbSNP:370885325
1536+a, tdbSNP:150791877
1545+c, tdbSNP:375599456
1553+c, tdbSNP:56398372
1563+c, tdbSNP:56205431
1583+a, g, tdbSNP:41557512
1586+c, tdbSNP:199950891
1599+g, tdbSNP:200101185
1620+c, tdbSNP:149980370
1621+a, gdbSNP:4150315
1630+a, gdbSNP:199587242
1642+c, gdbSNP:145157335
1658+c, tdbSNP:2227872
1658+c, tdbSNP:386561650
1664+a, gdbSNP:201185418
1665+a, gdbSNP:140080596
1683+g, tdbSNP:371251823
1684+c, tdbSNP:374911899
1685+a, gdbSNP:143667470
1700+c, tdbSNP:56115837
1701+c, tdbSNP:61757378
1702+a, gdbSNP:267603745
1713+c, tdbSNP:146853061
1743+a, tdbSNP:140656732
1748+c, tdbSNP:112825485
1749+a, gdbSNP:375907005
1754+c, gdbSNP:56109743
1797+a, c, tdbSNP:149867583
1798+a, gdbSNP:140135562
1805+c, gdbSNP:367722526
1840+c, tdbSNP:147240445
1866+c, tdbSNP:4150316
1900+g, tdbSNP:370292750
1924+c, tdbSNP:137877463
1925+a, gdbSNP:142081128
1948+g, tdbSNP:200503959
1956+c, tdbSNP:370851563
1962+c, tdbSNP:145853933
1986+a, gdbSNP:138854399
1989+a, gdbSNP:4150317
1997+c, tdbSNP:201684551
2012+c, gdbSNP:2227869
2013+c, tdbSNP:189067487
2067+c, tdbSNP:200615101
2092+g, tdbSNP:372128804
2095+a, gdbSNP:144645075
2098+a, tdbSNP:148062220
2117+a, gdbSNP:368200495
2120+a, gdbSNP:370456073
2137+c, tdbSNP:141763734
2192+c, tdbSNP:184579506
2194+a, gdbSNP:4150318
2215+c, gdbSNP:4150319
2228+a, gdbSNP:60682853
2236+g, tdbSNP:373893754
2252+a, tdbSNP:371842233
2278+a, gdbSNP:375506595
2306+a, cdbSNP:2227870
2360+c, tdbSNP:189280373
2400+dbSNP:
2400+a, gdbSNP:55686372
2411+a, gdbSNP:375848203
2436+a, cdbSNP:1803542
2465+a, gdbSNP:4987168
2497+a, gdbSNP:145295467
2526+a, cdbSNP:2228959
2534+a, gdbSNP:199651040
2554+a, gdbSNP:371246879
2588+c, tdbSNP:376753356
2589+a, gdbSNP:149224228
2616+c, tdbSNP:148103512
2634+dbSNP:
2634+c, gdbSNP:201744259
2655+c, tdbSNP:373289587
2707+a, gdbSNP:142438319
2721+c, tdbSNP:201206202
2722+a, gdbSNP:201581850
2746+dbSNP:
2746+a, gdbSNP:371529460
2786+c, tdbSNP:201666781
2790+a, gdbSNP:376917307
2801+c, tdbSNP:121434571
2802+a, gdbSNP:147571137
2811+a, cdbSNP:1047778
2823+g, tdbSNP:141936898
2838+c, tdbSNP:145905587
2847+c, tdbSNP:199648606
2871+c, gdbSNP:188442099
2875+g, tdbSNP:76871136
2880+a, gdbSNP:138715586
2883+a, gdbSNP:73573973
2889+a, cdbSNP:113119488
2890+c, tdbSNP:369151535
2912+a, gdbSNP:200554571
2913+c, tdbSNP:150351410
2940+c, gdbSNP:138020876
2970+dbSNP:
2970+c, gdbSNP:376485171
2976+a, gdbSNP:149541058
2999+c, tdbSNP:121434575
3015+c, tdbSNP:369464789
3045+c, tdbSNP:373958404
3046+a, gdbSNP:121434576
3062+a, gdbSNP:4150342
3078+, tdbSNP:34368380
3122+dbSNP:
3122+c, tdbSNP:370438771
3134+c, gdbSNP:138829032
3162+a, cdbSNP:373841284
3181+c, tdbSNP:377353991
3192+a, gdbSNP:370696670
3194+c, tdbSNP:375592438
3204+c, gdbSNP:9518857
3226+a, gdbSNP:201274165
3241+c, tdbSNP:371794669
3243+c, tdbSNP:374826471
3244+a, gdbSNP:146344855
3257+c, tdbSNP:201841889
3263+a, gdbSNP:139630009
3268+c, tdbSNP:200001652
3289+a, cdbSNP:142856022
3291+c, tdbSNP:150671111
3303+a, cdbSNP:41281674
3304+g, tdbSNP:121434570
3317+dbSNP:
3317+a, gdbSNP:149859074
3326..3327+, cdbSNP:34957536
3330+c, gdbSNP:267607280
3337+a, gdbSNP:147955525
3355+c, tdbSNP:375156536
3378+c, tdbSNP:199962177
3384+c, tdbSNP:185320470
3400+dbSNP:
3400+c, tdbSNP:373426451
3401+a, gdbSNP:377390651
3421+g, tdbSNP:368550097
3431+a, gdbSNP:41564320
3452+a, gdbSNP:4150387
3513+a, gdbSNP:200795364
3514+a, gdbSNP:376812170
3523+g, tdbSNP:41551412
3532+a, gdbSNP:144208043
3547+a, gdbSNP:201680306
3583+c, gdbSNP:9514066
3603+c, tdbSNP:148856875
3664+c, gdbSNP:9514067
3665+a, gdbSNP:4150388
3678+c, tdbSNP:372662617
3680+a, gdbSNP:200330676
3715+g, tdbSNP:374747511
complement(3736)-g, cdbSNP:17655
3762+c, tdbSNP:113688496
3782+c, tdbSNP:2227871
3783+a, gdbSNP:372634518
3797+a, cdbSNP:199696019
3812+c, tdbSNP:368829739
3838+a, gdbSNP:140930348
3846+c, tdbSNP:201369509
3850+c, gdbSNP:373398147
3853+a, gdbSNP:55798001
3854+a, cdbSNP:376411022
3855+a, gdbSNP:145649742
3869+c, gdbSNP:138123260
3875+a, gdbSNP:149597229
3885+c, tdbSNP:144274068
3898+c, gdbSNP:200867182
3913+a, gdbSNP:183317723
3918+a, c, tdbSNP:148782406
3930+a, gdbSNP:377761089
3934+a, gdbSNP:200699194
3936+a, gdbSNP:143198332
3945+a, gdbSNP:367643555
3950+a, gdbSNP:373434335
3959+a, gdbSNP:188710607
3961+g, tdbSNP:55843971
3963+a, gdbSNP:370035207
3977+a, gdbSNP:199925057
3980+a, cdbSNP:201911663
4011..4012+, attadbSNP:202029360
4011..4012+, attadbSNP:386591584
4014..4015+, attadbSNP:4150389
4017+c, tdbSNP:9676
4044+c, tdbSNP:150205001
4071+a, gdbSNP:873601
4076+a, gdbSNP:4150390
Gene SymbolERCC5
Gene SynonymCOFS3; ERCM2; UVDR; XPG; XPGC
Chromosome13
Locus Map13q33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000123 Homo sapiens excision repair cross-complementation group 5 (ERCC5), mRNA. On-demand $1699.00 25
Title Quantitative assessment of the association between XPG Asp1104His polymorphism and bladder cancer risk .
Author Liu C, Yin Q, Hu J, Weng J and Wang Y.
Journal Tumour Biol. 35 (2), 1203-1209 (2014)
Title Influence of polymorphisms in ERCC5, XPA and MTR DNA repair and synthesis genes in B-cell lymphoma risk. A case-control study in Spanish population .
Author Ruiz-Cosano J, Torres-Moreno D and Conesa-Zamora P.
Journal J BUON 18 (2), 486-490 (2013)
Title Predictive impact of common variations in DNA repair genes on clinical outcome of osteosarcoma .
Author Bai SB, Chen HX, Bao YX, Luo X and Zhong JJ.
Journal Asian Pac. J. Cancer Prev. 14 (6), 3677-3680 (2013)
Title Single nucleotide polymorphisms in the NER pathway and clinical outcome of patients with bone malignant tumors .
Author Sun XH, Hou WG, Zhao HX, Zhao YL, Ma C and Liu Y.
Journal Asian Pac. J. Cancer Prev. 14 (3), 2049-2052 (2013)
Title The human XPG gene: gene architecture, alternative splicing and single nucleotide polymorphisms .
Author Emmert S, Schneider TD, Khan SG and Kraemer KH.
Journal Nucleic Acids Res. 29 (7), 1443-1452 (2001)
Title Nomenclature of human DNA repair genes .
Author Lehmann AR, Bootsma D, Clarkson SG, Cleaver JE, McAlpine PJ, Tanaka K, Thompson LH and Wood RD.
Journal Mutat. Res. 315 (1), 41-42 (1994)
Title An ERCC5 gene with homology to yeast RAD2 is involved in group G xeroderma pigmentosum .
Author Shiomi T, Harada Y, Saito T, Shiomi N, Okuno Y and Yamaizumi M.
Journal Mutat. Res. 314 (2), 167-175 (1994)
Title Xeroderma Pigmentosum .
Author Kraemer,K.H. and DiGiovanna,J.J.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Precise localization of the excision repair gene, ERCC5, to human chromosome 13q32.3-q33.1 by direct R-banding fluorescence in situ hybridization .
Author Takahashi E, Shiomi N and Shiomi T.
Journal Jpn. J. Cancer Res. 83 (11), 1117-1119 (1992)
Title Isolation of the functional human excision repair gene ERCC5 by intercosmid recombination .
Author Mudgett JS and MacInnes MA.
Journal Genomics 8 (4), 623-633 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.