• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 5 (ERCC5), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000123 Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 5 (ERCC5), mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_000123.3, 324715039
Length 4091 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 5 (ERCC5), mRNA.
Product DNA repair protein complementing XP-G cells
Comment

Summary: This gene encodes a single-strand specific DNA endonuclease that makes the 3' incision in DNA excision repair following UV-induced damage. The protein may also function in other cellular processes, including RNA polymerase II transcription, and transcription-coupled DNA repair. Mutations in this gene cause xeroderma pigmentosum complementation group G (XP-G), which is also referred to as xeroderma pigmentosum VII (XP7), a skin disorder characterized by hypersensitivity to UV light and increased susceptibility for skin cancer development following UV exposure. Some patients also develop Cockayne syndrome, which is characterized by severe growth defects, mental retardation, and cachexia. Read-through transcription exists between this gene and the neighboring upstream BIVM (basic, immunoglobulin-like variable motif containing) gene. [provided by RefSeq, Feb 2011].

RefSeq NP_000114.2
CDS 427..3987
Misc Feature(1)382..384
Misc Feature(2)427..3498
Misc Feature(3)427..3498
Misc Feature(4)427..>816
Misc Feature(5)427..711
Misc Feature(6)448..450
Misc Feature(7)order(514..516,655..657)
Misc Feature(8)order(670..768,787..798,799..816)
Misc Feature(9)892..894
Misc Feature(10)892..894
Misc Feature(11)895..897
Misc Feature(12)895..897
Misc Feature(13)1438..1440
Misc Feature(14)1438..1440
Misc Feature(15)1447..1449
Misc Feature(16)1447..1449
Misc Feature(17)1489..1491
Misc Feature(18)1489..1491
Misc Feature(19)1492..1494
Misc Feature(20)1492..1494
Misc Feature(21)1495..1497
Misc Feature(22)1495..1497
Misc Feature(23)1513..1515
Misc Feature(24)1576..1578
Misc Feature(25)1576..1578
Misc Feature(26)1576..1578
Misc Feature(27)1693..1695
Misc Feature(28)1708..1710
Misc Feature(29)1708..1710
Misc Feature(30)2002..2004
Misc Feature(31)2002..2004
Misc Feature(32)2098..2100
Misc Feature(33)2101..2103
Misc Feature(34)2101..2103
Misc Feature(35)2110..2112
Misc Feature(36)2110..2112
Misc Feature(37)2113..2115
Misc Feature(38)2113..2115
Misc Feature(39)2113..2115
Misc Feature(40)2596..2598
Misc Feature(41)2683..3069
Misc Feature(42)<2698..2958
Misc Feature(43)order(2791..2793,2797..2799,2854..2856,2860..2862)
Misc Feature(44)order(2791..2793,2797..2799)
Misc Feature(45)order(2854..2856,2860..2862)
Misc Feature(46)2971..3255
Misc Feature(47)order(2998..3015,3019..3036,3040..3051)
Misc Feature(48)3007..3009
Misc Feature(49)<3265..3372
Misc Feature(50)3367..3453
Misc Feature(51)3595..3645
Exon (1)1..514
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (2)515..690
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (3)691..806
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (4)807..893
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (5)894..954
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (6)955..1098
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (7)1099..1306
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (8)1307..2380
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (9)2381..2625
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (10)2626..2745
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (11)2746..2959
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (12)2960..3104
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (13)3105..3305
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (14)3306..3390
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Exon (15)3391..4085
Gene:ERCC5
Gene Synonym:COFS3; ERCM2; UVDR; XPG; XPGC
Translation MGVQGLWKLLECSGRQVSPEALEGKILAVDISIWLNQALKGVRDRHGNSIENPHLLTLFH RLCKLLFFRIRPIFVFDGDAPLLKKQTLVKRRQRKDLASSDSRKTTEKLLKTFLKRQAIK TAFRSKRDEALPSLTQVRRENDLYVLPPLQEEEKHSSEEEDEKEWQERMNQKQALQEEFF HNPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQYQLKGLLKK NYLNQHIEHVQKEMNQQHSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTV AEVDSESLPSSSKMHGMSFDVKSSPCEKLKTEKEPDATPPSPRTLLAMQAALLGSSSEEE LESENRRQARGRNAPAAVDEGSISPRTLSAIKRALDDDEDVKVCAGDDVQTGGPGAEEMR INSSTENSDEGLKVRDGKGIPFTATLASSSVNSAEEHVASTNEGREPTDSVPKEQMSLVH VGTEAFPISDESMIKDRKDRLPLESAVVRHSDAPGLPNGRELTPASPTCTNSVSKNETHA EVLEQQNELCPYESKFDSSLLSSDDETKCKPNSASEVIGPVSLQETSSIVSVPSEAVDNV ENVVSFNAKEHENFLETIQEQQTTESAGQDLISIPKAVEPMEIDSEESESDGSFIEVQSV ISDEELQAEFPETSKPPSEQGEEELVGTREGEAPAESESLLRDNSERDDVDGEPQEAEKD AEDSLHEWQDINLEELETLESNLLAQQNSLKAQKQQQERIAATVTGQMFLESQELLRLFG IPYIQAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYRNFFNKNKFVEYYQYVDF HNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLLKFSEWWHEAQ KNPKIRPNPHDTKVKKKLRTLQLTPGFPNPAVAEAYLKPVVDDSKGSFLWGKPDLDKIRE FCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVT CMLRKEKEAAASEIEAVSVAMEKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKR KNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKN GGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
8+dbSNP:
8+c, tdbSNP:751402
185+c, tdbSNP:2296147
186+c, gdbSNP:4150249
227+c, gdbSNP:76752300
233..234+, agdbSNP:4150250
247+g, tdbSNP:151199206
265+g, tdbSNP:111985238
290+a, gdbSNP:112658526
353+a, gdbSNP:3218736
355+c, tdbSNP:2296148
364+a, tdbSNP:184274263
443+c, tdbSNP:113590348
474+a, gdbSNP:202038276
480+c, tdbSNP:201240143
482+c, tdbSNP:34291397
489+a, gdbSNP:200464030
560+dbSNP:
560+a, gdbSNP:140917545
564+c, tdbSNP:1047768
580+a, gdbSNP:141212999
641+a, cdbSNP:121434574
723+dbSNP:
723+c, tdbSNP:199515913
729+c, gdbSNP:150741329
738+a, gdbSNP:139161934
756+a, gdbSNP:143626350
802+a, cdbSNP:77569659
804+a, gdbSNP:147181939
832+dbSNP:
832+c, tdbSNP:121434577
838+c, tdbSNP:188898060
849+c, tdbSNP:140613269
855+c, gdbSNP:4140390
859+a, gdbSNP:4987063
868+c, tdbSNP:148503329
926..927+dbSNP:
926..927+, cdbSNP:36034203
926+a, gdbSNP:59731086
936+c, tdbSNP:142884592
952+c, tdbSNP:121434573
968+dbSNP:
968+a, gdbSNP:4150295
980+c, tdbSNP:151061520
1018+c, gdbSNP:141369732
1066+c, tdbSNP:56255799
1067+a, gdbSNP:146833751
1092+a, gdbSNP:140730525
1133+dbSNP:
1133+c, gdbSNP:201777503
1151+a, gdbSNP:150473997
1165+a, gdbSNP:200504271
1186+a, gdbSNP:1047769
1193+a, gdbSNP:4150313
1198+c, tdbSNP:143523137
1213+c, tdbSNP:121434572
1214+a, gdbSNP:61749896
1235+a, gdbSNP:183202756
1237+g, tdbSNP:187564382
1241+c, tdbSNP:41545721
1302+a, gdbSNP:193097418
1310+dbSNP:
1310+c, tdbSNP:112571039
1358+c, gdbSNP:2307491
1371+c, tdbSNP:34061299
1386+c, tdbSNP:4150314
1456+a, gdbSNP:142927249
1467+c, tdbSNP:116926104
1520+a, gdbSNP:201200441
1536+a, tdbSNP:150791877
1553+c, tdbSNP:56398372
1563+c, tdbSNP:56205431
1583+a, gdbSNP:41557512
1586+c, tdbSNP:199950891
1599+g, tdbSNP:200101185
1620+c, tdbSNP:149980370
1621+a, gdbSNP:4150315
1630+a, gdbSNP:199587242
1642+c, gdbSNP:145157335
1658+c, tdbSNP:2227872
1664+a, gdbSNP:201185418
1665+a, gdbSNP:140080596
1685+a, gdbSNP:143667470
1700+c, tdbSNP:56115837
1701+c, tdbSNP:61757378
1713+c, tdbSNP:146853061
1743+a, tdbSNP:140656732
1748+c, tdbSNP:112825485
1754+c, gdbSNP:56109743
1760+a, cdbSNP:151115650
1797+a, c, tdbSNP:149867583
1798+a, gdbSNP:140135562
1840+c, tdbSNP:147240445
1866+c, tdbSNP:4150316
1924+c, gdbSNP:137877463
1925+a, gdbSNP:142081128
1948+g, tdbSNP:200503959
1962+c, tdbSNP:145853933
1986+a, gdbSNP:138854399
1989+a, gdbSNP:4150317
1997+c, tdbSNP:201684551
2012+c, gdbSNP:2227869
2013+c, tdbSNP:189067487
2067+c, tdbSNP:200615101
2095+a, gdbSNP:144645075
2098+a, tdbSNP:148062220
2137+c, tdbSNP:141763734
2192+c, tdbSNP:184579506
2194+a, gdbSNP:4150318
2215+c, gdbSNP:4150319
2228+a, gdbSNP:60682853
2306+a, cdbSNP:2227870
2360+c, tdbSNP:189280373
2400+dbSNP:
2400+a, gdbSNP:55686372
2427+a, gdbSNP:139730545
2436+a, cdbSNP:1803542
2465+a, gdbSNP:4987168
2497+a, gdbSNP:145295467
2526+a, cdbSNP:2228959
2534+a, gdbSNP:199651040
2589+a, gdbSNP:149224228
2616+c, tdbSNP:148103512
2634+dbSNP:
2634+c, gdbSNP:201744259
2707+a, gdbSNP:142438319
2721+c, tdbSNP:201206202
2722+a, gdbSNP:201581850
2786+dbSNP:
2786+c, tdbSNP:201666781
2801+c, tdbSNP:121434571
2802+a, gdbSNP:147571137
2811+a, cdbSNP:1047778
2823+g, tdbSNP:141936898
2838+c, tdbSNP:145905587
2847+c, tdbSNP:199648606
2871+c, gdbSNP:188442099
2875+g, tdbSNP:76871136
2880+a, gdbSNP:138715586
2883+a, gdbSNP:73573973
2889+a, cdbSNP:113119488
2912+a, gdbSNP:200554571
2913+c, tdbSNP:150351410
2940+c, gdbSNP:138020876
2976+dbSNP:
2976+a, gdbSNP:149541058
2999+c, tdbSNP:121434575
3046+a, gdbSNP:121434576
3062+a, gdbSNP:4150342
3078+, tdbSNP:34368380
3134+dbSNP:
3134+c, gdbSNP:138829032
3204+c, gdbSNP:9518857
3226+a, gdbSNP:201274165
3244+a, gdbSNP:146344855
3257+c, tdbSNP:201841889
3263+a, gdbSNP:139630009
3268+c, tdbSNP:200001652
3289+a, cdbSNP:142856022
3291+c, tdbSNP:150671111
3303+a, cdbSNP:41281674
3304+g, tdbSNP:121434570
3317+dbSNP:
3317+a, gdbSNP:149859074
3326..3327+, cdbSNP:34957536
3337+a, gdbSNP:147955525
3378+c, tdbSNP:199962177
3384+c, tdbSNP:185320470
3431+dbSNP:
3431+a, gdbSNP:41564320
3452+a, gdbSNP:4150387
3513+a, gdbSNP:200795364
3523+g, tdbSNP:41551412
3532+a, gdbSNP:144208043
3547+a, gdbSNP:201680306
3583+c, gdbSNP:9514066
3603+c, tdbSNP:148856875
3664+c, gdbSNP:9514067
3665+a, gdbSNP:4150388
3680+a, gdbSNP:200330676
3736+c, gdbSNP:17655
3762+c, tdbSNP:113688496
3782+c, tdbSNP:2227871
3797+a, cdbSNP:199696019
3838+a, gdbSNP:140930348
3843+g, tdbSNP:138754048
3846+c, tdbSNP:201369509
3853+a, gdbSNP:55798001
3855+a, gdbSNP:145649742
3869+c, gdbSNP:138123260
3875+a, gdbSNP:149597229
3885+c, tdbSNP:144274068
3898+c, gdbSNP:200867182
3913+a, gdbSNP:183317723
3918+a, cdbSNP:148782406
3934+a, gdbSNP:200699194
3936+a, gdbSNP:143198332
3959+a, gdbSNP:188710607
3961+g, tdbSNP:55843971
3977+a, gdbSNP:199925057
3980+a, cdbSNP:201911663
4011..4015+, attadbSNP:75627689
4011..4014+, attadbSNP:4150389
4011..4012+, attadbSNP:202029360
4017+c, tdbSNP:9676
4044+c, tdbSNP:150205001
4071+a, gdbSNP:873601
4076+a, gdbSNP:4150390
Gene SymbolERCC5
Gene SynonymCOFS3; ERCM2; UVDR; XPG; XPGC
Chromosome13
Locus Map13q33
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000123 Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation group 5 (ERCC5), mRNA. On-demand $1699.00 25
Title Promoter polymorphisms in DNA repair gene ERCC5 and susceptibility to gastric cancer in Chinese .
Author Duan,Z., He,C., Gong,Y., Li,P., Xu,Q., Sun,L.P., Wang,Z., Xing,C. and Yuan,Y.
Journal Gene 511 (2), 274-279 (2012)
Title [Effect of XPG down-regulation gene expression towards the proliferation of epithelial ovarian cancer cells and its chemosensitivity to platinum] .
Author Zhang,W., Wu,F.X., Wang,Q. and Li,L.
Journal Zhonghua Fu Chan Ke Za Zhi 47 (4), 286-291 (2012)
Title Polymorphisms in the ERCC5 gene and risk of esophageal squamous cell carcinoma (ESCC) in Eastern Chinese populations .
Author Zhu,M.L., Shi,T.Y., Hu,H.C., He,J., Wang,M., Jin,L., Yang,Y.J., Wang,J.C., Sun,M.H., Chen,H., Zhao,K.L., Zhang,Z., Chen,H.Q., Xiang,J.Q. and Wei,Q.Y.
Journal PLoS ONE 7 (7), E41500 (2012)
Title Association between the ERCC5 Asp1104His polymorphism and cancer risk: a meta-analysis .
Author Zhu,M.L., Wang,M., Cao,Z.G., He,J., Shi,T.Y., Xia,K.Q., Qiu,L.X. and Wei,Q.Y.
Journal PLoS ONE 7 (7), E36293 (2012)
Title The human XPG gene: gene architecture, alternative splicing and single nucleotide polymorphisms .
Author Emmert,S., Schneider,T.D., Khan,S.G. and Kraemer,K.H.
Journal Nucleic Acids Res. 29 (7), 1443-1452 (2001)
Title XPG protein has a structure-specific endonuclease activity .
Author Cloud,K.G., Shen,B., Strniste,G.F. and Park,M.S.
Journal Mutat. Res. 347 (2), 55-60 (1995)
Title Nomenclature of human DNA repair genes .
Author Lehmann,A.R., Bootsma,D., Clarkson,S.G., Cleaver,J.E., McAlpine,P.J., Tanaka,K., Thompson,L.H. and Wood,R.D.
Journal Mutat. Res. 315 (1), 41-42 (1994)
Title An ERCC5 gene with homology to yeast RAD2 is involved in group G xeroderma pigmentosum .
Author Shiomi,T., Harada,Y., Saito,T., Shiomi,N., Okuno,Y. and Yamaizumi,M.
Journal Mutat. Res. 314 (2), 167-175 (1994)
Title Precise localization of the excision repair gene, ERCC5, to human chromosome 13q32.3-q33.1 by direct R-banding fluorescence in situ hybridization .
Author Takahashi,E., Shiomi,N. and Shiomi,T.
Journal Jpn. J. Cancer Res. 83 (11), 1117-1119 (1992)
Title Isolation of the functional human excision repair gene ERCC5 by intercosmid recombination .
Author Mudgett,J.S. and MacInnes,M.A.
Journal Genomics 8 (4), 623-633 (1990)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.