• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens coagulation factor XIII, A1 polypeptide (F13A1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25882 Homo sapiens coagulation factor XIII, A1 polypeptide (F13A1), mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu25882C Homo sapiens coagulation factor XIII, A1 polypeptide (F13A1), mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000129.3, 119395708
Length 2199 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens coagulation factor XIII, A1 polypeptide (F13A1), mRNA.
Product coagulation factor XIII A chain precursor
Comment

Summary: This gene encodes the coagulation factor XIII A subunit. Coagulation factor XIII is the last zymogen to become activated in the blood coagulation cascade. Plasma factor XIII is a heterotetramer composed of 2 A subunits and 2 B subunits. The A subunits have catalytic function, and the B subunits do not have enzymatic activity and may serve as plasma carrier molecules. Platelet factor XIII is comprised only of 2 A subunits, which are identical to those of plasma origin. Upon cleavage of the activation peptide by thrombin and in the presence of calcium ion, the plasma factor XIII dissociates its B subunits and yields the same active enzyme, factor XIIIa, as platelet factor XIII. This enzyme acts as a transglutaminase to catalyze the formation of gamma-glutamyl-epsilon-lysine crosslinking between fibrin molecules, thus stabilizing the fibrin clot. It also crosslinks alpha-2-plasmin inhibitor, or fibronectin, to the alpha chains of fibrin. Factor XIII deficiency is classified into two categories: type I deficiency, characterized by the lack of both the A and B subunits; and type II deficiency, characterized by the lack of the A subunit alone. These defects can result in a lifelong bleeding tendency, defective wound healing, and habitual abortion. [provided by RefSeq, Jul 2008].

RefSeq NP_000120.2
CDS 124..2322
Misc Feature(1)4..6
Misc Feature(2)4..6
Misc Feature(3)127..237
Misc Feature(4)235..240
Misc Feature(5)259..624
Misc Feature(6)<973..1347
Misc Feature(7)1048..1323
Misc Feature(8)1678..1992
Misc Feature(9)2014..2307
Exon (1)1..105
Gene:F13A1
Gene Synonym:F13A
Exon (2)106..253
Gene:F13A1
Gene Synonym:F13A
Exon (3)254..442
Gene:F13A1
Gene Synonym:F13A
Exon (4)443..694
Gene:F13A1
Gene Synonym:F13A
Exon (5)695..813
Gene:F13A1
Gene Synonym:F13A
Exon (6)814..921
Gene:F13A1
Gene Synonym:F13A
Exon (7)922..1096
Gene:F13A1
Gene Synonym:F13A
Exon (8)1097..1235
Gene:F13A1
Gene Synonym:F13A
Exon (9)1236..1339
Gene:F13A1
Gene Synonym:F13A
Exon (10)1340..1428
Gene:F13A1
Gene Synonym:F13A
Exon (11)1429..1582
Gene:F13A1
Gene Synonym:F13A
Exon (12)1583..1870
Gene:F13A1
Gene Synonym:F13A
Exon (13)1871..2031
Gene:F13A1
Gene Synonym:F13A
Exon (14)2032..2168
Gene:F13A1
Gene Synonym:F13A
Exon (15)2169..3863
Gene:F13A1
Gene Synonym:F13A
Translation MSETSRTAFGGRRAVPPNNSNAAEDDLPTVELQGVVPRGVNLQEFLNVTSVHLFKERWDT NKVDHHTDKYENNKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPV PIVSELQSGKWGAKIVMREDRSVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETD TYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFYGEVNDIKTRSWSYGQFEDGILDTCL YVMDRAQMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL LEYRSSENPVRYGQCWVFAGVFNTFLRCLGIPARIVTNYFSAHDNDANLQMDIFLEEDGN VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH GHVCFQFDAPFVFAEVNSDLIYITAKKDGTHVVENVDATHIGKLIVTKQIGGDGMMDITD TYKFQEGQEEERLALETALMYGAKKPLNTEGVMKSRSNVDMDFEVENAVLGKDFKLSITF RNNSHNRYTITAYLSANITFYTGVPKAEFKKETFDVTLEPLSFKKEAVLIQAGEYMGQLL EQASLHFFVTARINETRDVLAKQKSTVLTIPEIIIKVRGTQVVGSDMTVTVEFTNPLKET LRNVWVHLDGPGVTRPMKKMFREIRPNSTVQWEEVCRPWVSGHRKLIASMSSDSLRHVYG ELDVQIQRRPSM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(29)-g, adbSNP:192331652
complement(51)-t, gdbSNP:187436054
91+c, gdbSNP:3024311
complement(144)-g, adbSNP:372025904
complement(145)-t, cdbSNP:138865075
complement(166)-t, cdbSNP:367893759
complement(192)-t, cdbSNP:375325264
complement(225)-g, adbSNP:187027323
226+g, tdbSNP:5985
complement(240)-g, adbSNP:181003679
complement(241)-g, adbSNP:3024472
complement(255)-dbSNP:
complement(255)-c, adbSNP:148065753
complement(269)-g, adbSNP:143616920
complement(273)-g, adbSNP:148898698
complement(283)-t, adbSNP:138690353
306+a, cdbSNP:121913067
complement(312)-t, cdbSNP:201149092
complement(334)-t, cdbSNP:267601095
complement(359)-t, cdbSNP:267601094
388+c, tdbSNP:1050777
complement(414)-t, cdbSNP:368614035
complement(446)-dbSNP:
complement(446)-t, cdbSNP:145761347
complement(476..477)-, adbSNP:34982225
complement(483)-t, cdbSNP:370857061
complement(487)-t, cdbSNP:142064728
complement(498)-g, cdbSNP:147577601
complement(502)-g, adbSNP:150249786
complement(507)-c, adbSNP:376635947
complement(520)-c, adbSNP:141030077
complement(536)-t, cdbSNP:202087752
complement(554)-t, cdbSNP:142954620
complement(631)-t, cdbSNP:140712764
637+c, tdbSNP:121913065
complement(638)-t, cdbSNP:376147795
complement(640)-t, cdbSNP:142994919
complement(642)-g, cdbSNP:199948219
complement(653)-t, gdbSNP:139753440
complement(718)-dbSNP:
complement(718)-t, cdbSNP:267601093
complement(728)-t, cdbSNP:146801542
complement(737)-t, adbSNP:3024477
complement(767)-t, adbSNP:373039706
complement(783)-g, adbSNP:143741081
complement(843)-dbSNP:
complement(843)-t, cdbSNP:140082834
851+c, tdbSNP:267606788
complement(864)-t, cdbSNP:146083032
complement(880)-t, gdbSNP:375359206
complement(896)-t, cdbSNP:142092590
905+a, gdbSNP:121913071
complement(951)-dbSNP:
complement(951)-g, adbSNP:200522503
974+a, gdbSNP:121913074
complement(985)-t, cdbSNP:370205818
complement(988)-t, gdbSNP:201752338
complement(996)-t, cdbSNP:376329240
complement(1012)-t, cdbSNP:199564311
complement(1030)-g, adbSNP:201512428
complement(1034)-t, cdbSNP:139164988
complement(1055)-t, cdbSNP:376482294
1072+g, tdbSNP:121913073
complement(1095)-t, cdbSNP:372688880
1103+dbSNP:
1103+a, gdbSNP:121913072
1107+a, cdbSNP:202247810
1119+a, cdbSNP:5981
complement(1142..1143)-, adbSNP:35516060
complement(1155)-g, adbSNP:142274716
1175+a, tdbSNP:2230848
complement(1184)-t, adbSNP:369083276
complement(1203)-g, adbSNP:145775675
complement(1218)-g, adbSNP:143382521
complement(1275)-dbSNP:
complement(1275)-g, adbSNP:375255557
complement(1307)-g, adbSNP:76451285
complement(1340)-dbSNP:
complement(1340)-g, cdbSNP:138036988
complement(1360)-t, cdbSNP:139636536
1366+g, tdbSNP:121913070
complement(1394)-t, cdbSNP:371619552
complement(1409)-g, adbSNP:143513902
complement(1438)-dbSNP:
complement(1438)-t, cdbSNP:145376560
1449+a, cdbSNP:121913066
complement(1477)-t, cdbSNP:373405542
complement(1482)-t, cdbSNP:369983817
complement(1528)-g, cdbSNP:150455213
1542+c, tdbSNP:3024438
complement(1550)-c, adbSNP:375123237
complement(1589)-dbSNP:
complement(1589)-t, cdbSNP:146866566
complement(1626)-g, adbSNP:372036357
1627+a, gdbSNP:121913068
complement(1652)-t, adbSNP:375270793
complement(1674)-g, adbSNP:143608819
complement(1676)-t, cdbSNP:369134587
complement(1677)-g, adbSNP:371668009
complement(1681)-t, cdbSNP:140037971
complement(1699)-t, cdbSNP:144411857
complement(1717)-t, cdbSNP:55874054
complement(1727)-t, cdbSNP:151032137
complement(1743)-g, adbSNP:142891701
complement(1745)-t, cdbSNP:367679357
complement(1763)-t, cdbSNP:374508373
complement(1775)-t, cdbSNP:5984
complement(1787)-g, adbSNP:201203914
complement(1809)-g, adbSNP:145630742
1810+a, gdbSNP:121913069
complement(1812)-t, cdbSNP:58315745
1817+c, tdbSNP:5982
complement(1818)-t, cdbSNP:372651461
1827+a, gdbSNP:5986
complement(1841)-g, adbSNP:113599940
complement(1846)-g, cdbSNP:201444282
complement(1848)-g, adbSNP:368622521
complement(1849)-t, cdbSNP:61734486
complement(1853)-g, adbSNP:143711562
complement(1854)-t, cdbSNP:137945179
complement(1884)-dbSNP:
complement(1884)-t, cdbSNP:377479323
complement(1889)-t, adbSNP:5983
complement(1899)-g, adbSNP:376162615
complement(1900)-t, cdbSNP:138754417
complement(1913)-c, adbSNP:201173378
complement(1930)-t, cdbSNP:376690763
complement(1931)-g, adbSNP:148207995
complement(1939)-t, gdbSNP:373723380
complement(1956)-g, adbSNP:143769071
complement(1958)-t, cdbSNP:369187276
complement(1960)-t, cdbSNP:140646752
complement(1983)-g, cdbSNP:138943514
complement(1984)-c, adbSNP:145180358
complement(1987)-t, cdbSNP:141416839
complement(1996)-c, adbSNP:145219717
complement(2001)-t, gdbSNP:149970442
complement(2002)-t, cdbSNP:200830173
complement(2016)-g, adbSNP:199801179
complement(2027)-g, adbSNP:372738301
complement(2031)-t, cdbSNP:185994460
complement(2035)-dbSNP:
complement(2035)-g, adbSNP:200803360
complement(2072)-g, adbSNP:17852475
2074+a, gdbSNP:5987
2077+c, gdbSNP:5988
2107+c, tdbSNP:267606789
complement(2127)-t, cdbSNP:371552316
complement(2129)-t, cdbSNP:375129902
complement(2152)-t, cdbSNP:371964182
complement(2159)-t, adbSNP:201302247
2168+a, g, tdbSNP:121913064
complement(2177)-dbSNP:
complement(2177)-t, cdbSNP:184352526
2233+c, tdbSNP:267606787
complement(2234)-t, cdbSNP:377484555
complement(2253)-t, cdbSNP:140537838
complement(2262)-g, adbSNP:200672690
complement(2270)-t, cdbSNP:147189258
complement(2274)-g, adbSNP:145319551
2292+c, tdbSNP:5989
complement(2389)-g, adbSNP:182425546
complement(2411)-g, adbSNP:3024462
complement(2411)-g, adbSNP:386578681
complement(2412)-g, adbSNP:190347458
complement(2434)-t, gdbSNP:3024463
2448+c, tdbSNP:1050782
2482+a, gdbSNP:1050783
complement(2495)-g, adbSNP:184669742
complement(2514)-t, cdbSNP:113481403
complement(2530)-g, adbSNP:192234804
complement(2543)-g, adbSNP:3024464
complement(2564)-t, cdbSNP:201487086
complement(2740)-g, cdbSNP:187149870
complement(2750)-t, gdbSNP:138139907
2765+a, gdbSNP:3024486
complement(2765)-g, adbSNP:386578684
complement(2820)-t, cdbSNP:371291195
complement(2851)-g, cdbSNP:368328824
complement(2885)-t, gdbSNP:184052140
complement(2907)-t, adbSNP:3024465
complement(2909)-t, cdbSNP:75981686
complement(2928)-g, adbSNP:148907610
complement(2937..2938)-, tdbSNP:34270368
complement(2941)-g, adbSNP:191569585
complement(3065)-g, adbSNP:12862
complement(3065)-g, adbSNP:386526294
complement(3118)-t, cdbSNP:56039031
3288+a, cdbSNP:138629563
3317+g, tdbSNP:3024466
3362+a, gdbSNP:150404339
complement(3364)-g, cdbSNP:113785944
3367+c, gdbSNP:3024487
3389+c, tdbSNP:11511
complement(3567)-t, adbSNP:140551231
complement(3572)-g, adbSNP:77424672
3575+a, c, tdbSNP:1803604
complement(3622)-g, adbSNP:57154463
complement(3639)-t, adbSNP:373635829
3710+c, tdbSNP:14901
complement(3762)-t, cdbSNP:183287566
complement(3822)-t, cdbSNP:143723129
Gene SymbolF13A1
Gene SynonymF13A
Chromosome6
Locus Map6p25.3-p24.3
Title Factor XIII: congenital deficiency factor XIII, acquired deficiency, factor XIII A-subunit, and factor XIII B-subunit .
Author Tahlan A and Ahluwalia J.
Journal Arch. Pathol. Lab. Med. 138 (2), 278-281 (2014)
Title Down-regulation of Fas-mediated apoptosis by plasma transglutaminase factor XIII that catalyzes fetal-specific cross-link of the Fas molecule .
Author Kikuchi H, Kuribayashi F and Imajoh-Ohmi S.
Journal Biochem. Biophys. Res. Commun. 443 (1), 13-17 (2014)
Title Factor XIII deficiency: an update .
Author Schroeder V and Kohler HP.
Journal Semin. Thromb. Hemost. 39 (6), 632-641 (2013)
Title Increased expression of factor XIII-A in patients with chronic rhinosinusitis with nasal polyps .
Author Takabayashi T, Kato A, Peters AT, Hulse KE, Suh LA, Carter R, Norton J, Grammer LC, Tan BK, Chandra RK, Conley DB, Kern RC, Fujieda S and Schleimer RP.
Journal J. Allergy Clin. Immunol. 132 (3), 584-592 (2013)
Title The effect of FXIII-A Val34Leu genotype on the risk of peripheral arterial disease .
Author Szomjak,E., Csiki,Z., Zsori,K.S., Andras,C. and Shemirani,A.H.
Journal Blood Coagul. Fibrinolysis 24 (3), 351-352 (2013)
Title Identification of a point mutation in factor XIII A subunit deficiency .
Author Board P, Coggan M and Miloszewski K.
Journal Blood 80 (4), 937-941 (1992)
Title Deficiency of coagulation factor XIII A subunit caused by the dinucleotide deletion at the 5' end of exon III .
Author Kamura T, Okamura T, Murakawa M, Tsuda H, Teshima T, Shibuya T, Harada M and Niho Y.
Journal J. Clin. Invest. 90 (2), 315-319 (1992)
Title The presence of a covalently cross-linked matrix in human platelets .
Author Harsfalvi J, Fesus L, Tarcsa E, Laczko J and Loewy AG.
Journal Biochim. Biophys. Acta 1073 (2), 268-274 (1991)
Title Crystallization of blood coagulation factor XIII by an automated procedure .
Author Hilgenfeld R, Liesum A, Storm R, Metzner HJ and Karges HE.
Journal FEBS Lett. 265 (1-2), 110-112 (1990)
Title Expression, purification, and characterization of human factor XIII in Saccharomyces cerevisiae .
Author Bishop PD, Teller DC, Smith RA, Lasser GW, Gilbert T and Seale RL.
Journal Biochemistry 29 (7), 1861-1869 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.