• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens coagulation factor V (proaccelerin, labile factor) (F5), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu26030 Homo sapiens coagulation factor V (proaccelerin, labile factor) (F5), mRNA. pcDNA3.1+-DYK On-demand TBD -1
OHu26030C Homo sapiens coagulation factor V (proaccelerin, labile factor) (F5), mRNA. Customized vector On-demand TBD -1

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000130.4, 119395710
Length 6675 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens coagulation factor V (proaccelerin, labile factor) (F5), mRNA.
Product coagulation factor V precursor
Comment

Summary: This gene encodes an essential cofactor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The activated protein is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in this gene result in either an autosomal recessive hemorrhagic diathesis or an autosomal dominant form of thrombophilia, which is known as activated protein C resistance. [provided by RefSeq, Oct 2008].

RefSeq NP_000121.2
CDS 146..6820
Misc Feature(1)80..82
Misc Feature(2)80..82
Misc Feature(3)230..2356
Misc Feature(4)239..733
Misc Feature(5)767..1123
Misc Feature(6)1145..1150
Misc Feature(7)1145..1147
Misc Feature(8)1187..1729
Misc Feature(9)1250..1252
Misc Feature(10)1745..1750
Misc Feature(11)1745..1747
Misc Feature(12)1751..1753
Misc Feature(13)1766..2197
Misc Feature(14)2063..2065
Misc Feature(15)2219..2221
Misc Feature(16)2264..2269
Misc Feature(17)2264..2266
Misc Feature(18)2354..2359
Misc Feature(19)2354..2356
Misc Feature(20)2357..4864
Misc Feature(21)2684..2686
Misc Feature(22)3209..3214
Misc Feature(23)3209..3211
Misc Feature(24)3281..3286
Misc Feature(25)3281..3283
Misc Feature(26)3803..3805
Misc Feature(27)3872..>4507
Misc Feature(28)4679..4681
Misc Feature(29)4862..4867
Misc Feature(30)4865..6817
Misc Feature(31)4880..5407
Misc Feature(32)order(4907..4909,4916..4918,4922..4927,4931..4936,
Misc Feature(33)5252..5254
Misc Feature(34)5441..5851
Misc Feature(35)5528..5530
Misc Feature(36)5870..6325
Misc Feature(37)order(5990..5992,6086..6088,6107..6109)
Misc Feature(38)6173..6175
Misc Feature(39)6347..6805
Misc Feature(40)order(6482..6484,6566..6568,6587..6589)
Misc Feature(41)6686..6688
Misc Feature(42)6770..6772
Exon (1)1..303
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (2)304..395
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (3)396..518
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (4)519..731
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (5)732..875
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (6)876..1097
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (7)1098..1263
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (8)1264..1441
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (9)1442..1541
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (10)1542..1756
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (11)1757..1907
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (12)1908..2120
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (13)2121..4941
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (14)4942..5116
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (15)5117..5353
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (16)5354..5564
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (17)5565..5744
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (18)5745..5861
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (19)5862..5933
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (20)5934..6037
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (21)6038..6193
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (22)6194..6338
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (23)6339..6490
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (24)6491..6673
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (25)6674..9179
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Translation MFPGCPRLWVLVVLGTSWVGWGSQGTEAAQLRQFYVAAQGISWSYRPEPTNSSLNLSVTS FKKIVYREYEPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKNKADKPLSIHPQGIRYS KLSEGASYLDHTFPAEKMDDAVAPGREYTYEWSISEDSGPTHDDPPCLTHIYYSHENLIE DFNSGLIGPLLICKKGTLTEGGTQKTFDKQIVLLFAVFDESKSWSQSSSLMYTVNGYVNG TMPDITVCAHDHISWHLLGMSSGPELFSIHFNGQVLEQNHHKVSAITLVSATSTTANMTV GPEGKWIISSLTPKHLQAGMQAYIDIKNCPKKTRNLKKITREQRRHMKRWEYFIAAEEVI WDYAPVIPANMDKKYRSQHLDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMKEDGILG PIIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDEVNSSFTSGRNNTMIRAVQPGET YTYKWNILEFDEPTENDAQCLTRPYYSDVDIMRDIASGLIGLLLICKSRSLDRRGIQRAA DIEQQAVFAVFDENKSWYLEDNINKFCENPDEVKRDDPKFYESNIMSTINGYVPESITTL GFCFDDTVQWHFCSVGTQNEILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTMDNVGT WMLTSMNSSPRSKKLRLKFRDVKCIPDDDEDSYEIFEPPESTVMATRKMHDRLEPEDEES DADYDYQNRLAAALGIRSFRNSSLNQEEEEFNLTALALENGTEFVSSNTDIIVGSNYSSP SNISKFTVNNLAEPQKAPSHQQATTAGSPLRHLIGKNSVLNSSTAEHSSPYSEDPIEDPL QPDVTGIRLLSLGAGEFKSQEHAKHKGPKVERDQAAKHRFSWMKLLAHKVGRHLSQDTGS PSGMRPWEDLPSQDTGSPSRMRPWKDPPSDLLLLKQSNSSKILVGRWHLASEKGSYEIIQ DTDEDTAVNNWLISPQNASRAWGESTPLANKPGKQSGHPKFPRVRHKSLQVRQDGGKSRL KKSQFLIKTRKKKKEKHTHHAPLSPRTFHPLRSEAYNTFSERRLKHSLVLHKSNETSLPT DLNQTLPSMDFGWIASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHS TSDPSHRSSSPELSEMLEYDRSHKSFPTDISQMSPSSEHEVWQTVISPDLSQVTLSPELS QTNLSPDLSHTTLSPELIQRNLSPALGQMPISPDLSHTTLSPDLSHTTLSLDLSQTNLSP ELSQTNLSPALGQMPLSPDLSHTTLSLDFSQTNLSPELSHMTLSPELSQTNLSPALGQMP ISPDLSHTTLSLDFSQTNLSPELSQTNLSPALGQMPLSPDPSHTTLSLDLSQTNLSPELS QTNLSPDLSEMPLFADLSQIPLTPDLDQMTLSPDLGETDLSPNFGQMSLSPDLSQVTLSP DISDTTLLPDLSQISPPPDLDQIFYPSESSQSLLLQEFNESFPYPDLGQMPSPSSPTLND TFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINS SRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTTYKKVVF RKYLDSTFTKRDPRGEYEEHLGILGPIIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKS SEGKTYEDDSPEWFKEDNAVQPNSSYTYVWHATERSGPESPGSACRAWAYYSAVNPEKDI HSGLIGPLLICQKGILHKDSNMPMDMREFVLLFMTFDEKKSWYYEKKSRSSWRLTSSEMK KSHEFHAINGMIYSLPGLKMYEQEWVRLHLLNIGGSQDIHVVHFHGQTLLENGNKQHQLG VWPLLPGSFKTLEMKASKPGWWLLNTEVGENQRAGMQTPFLIMDRDCRMPMGLSTGIISD SQIKASEFLGYWEPRLARLNNGGSYNAWSVEKLAAEFASKPWIQVDMQKEVIITGIQTQG AKHYLKSCYTTEFYVAYSSNQINWQIFKGNSTRNVMYFNGNSDASTIKENQFDPPIVARY IRISPTRAYNRPTLRLELQGCEVNGCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFR ARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQ GVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSIALRLELFG CDIY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(106)-g, adbSNP:41272465
complement(139)-t, cdbSNP:147121485
complement(157)-g, adbSNP:367843391
complement(188)-g, adbSNP:9332485
complement(251)-t, cdbSNP:147487854
complement(257)-c, adbSNP:184663825
complement(281)-g, cdbSNP:140598745
complement(320)-dbSNP:
complement(320)-t, gdbSNP:267598158
complement(352)-g, adbSNP:371185688
complement(382)-t, cdbSNP:6028
complement(389)-t, cdbSNP:377674263
complement(399)-dbSNP:
complement(399)-c, adbSNP:146656273
complement(416)-g, adbSNP:367901835
complement(427)-g, adbSNP:201439832
complement(428)-t, cdbSNP:376110672
complement(433)-g, adbSNP:200217111
complement(435)-t, adbSNP:144675474
464+c, gdbSNP:6019
complement(489)-t, cdbSNP:201278820
complement(514)-t, adbSNP:371756875
complement(544)-dbSNP:
complement(544)-t, gdbSNP:373541623
complement(549)-g, adbSNP:200765676
550+a, gdbSNP:6029
complement(550)-g, adbSNP:386601153
complement(582)-t, cdbSNP:145625079
584+g, tdbSNP:118203912
complement(598)-t, adbSNP:369740525
complement(643)-t, cdbSNP:113249658
complement(655)-g, adbSNP:375660526
complement(669)-t, cdbSNP:201510575
complement(683)-t, cdbSNP:143152035
697+g, tdbSNP:6022
complement(709)-g, cdbSNP:1557573
complement(711)-g, adbSNP:141800405
complement(732)-dbSNP:
complement(732)-t, cdbSNP:145976832
complement(763)-t, cdbSNP:149072504
complement(773)-t, gdbSNP:144937515
complement(872)-t, gdbSNP:368524944
complement(883)-dbSNP:
complement(883)-t, cdbSNP:375739973
complement(893)-g, adbSNP:370524742
complement(914)-g, adbSNP:12118441
complement(930)-g, c, adbSNP:201865717
complement(946)-t, gdbSNP:201002212
complement(961)-t, cdbSNP:9332578
complement(967)-g, cdbSNP:374669298
complement(970)-g, adbSNP:144375278
complement(974)-g, cdbSNP:370383592
complement(1005)-t, gdbSNP:141847118
complement(1007)-g, adbSNP:147889072
complement(1023)-g, cdbSNP:200984834
complement(1028)-t, cdbSNP:371760153
complement(1030)-g, adbSNP:148752831
complement(1036)-g, adbSNP:139147538
complement(1060)-t, cdbSNP:141898470
complement(1107)-dbSNP:
complement(1107)-t, cdbSNP:373871970
complement(1115)-t, cdbSNP:145948938
complement(1116)-g, adbSNP:141622672
complement(1141)-t, gdbSNP:143509841
1145+a, gdbSNP:118203905
1146+c, gdbSNP:118203906
complement(1149)-t, adbSNP:369986546
complement(1166)-g, adbSNP:200532195
complement(1179)-t, cdbSNP:201078171
complement(1204)-g, cdbSNP:200531616
complement(1206)-g, adbSNP:373183037
complement(1231)-g, adbSNP:147952496
complement(1251)-g, adbSNP:200934105
complement(1257)-g, adbSNP:201493488
complement(1260)-t, adbSNP:370875907
complement(1273)-dbSNP:
complement(1273)-c, adbSNP:373172802
complement(1299)-t, cdbSNP:371770676
complement(1303)-t, cdbSNP:148623862
1305+c, tdbSNP:118203911
complement(1320)-t, cdbSNP:369129314
complement(1326)-g, adbSNP:142875000
complement(1373)-t, gdbSNP:372690115
complement(1383)-g, adbSNP:6033
complement(1387)-t, cdbSNP:6035
complement(1427)-t, cdbSNP:200657450
complement(1485)-dbSNP:
complement(1485)-g, adbSNP:368387623
complement(1510)-g, adbSNP:146035166
complement(1519)-t, cdbSNP:150708584
complement(1525)-t, cdbSNP:386601069
1525+c, tdbSNP:6015
complement(1536)-g, adbSNP:141768227
complement(1588)-dbSNP:
complement(1588)-g, adbSNP:374301361
complement(1597)-g, cdbSNP:139213790
complement(1606)-g, adbSNP:267598157
1683+a, gdbSNP:6020
complement(1684)-t, cdbSNP:140627208
complement(1709)-g, cdbSNP:143663052
1746+a, gdbSNP:6025
complement(1804)-dbSNP:
complement(1804)-t, cdbSNP:370739570
complement(1807)-g, adbSNP:376310610
1861+a, gdbSNP:6036
complement(1861)-g, adbSNP:386601194
complement(1917)-dbSNP:
complement(1917)-c, adbSNP:369354157
complement(1921)-g, adbSNP:149240688
complement(1930)-t, cdbSNP:112333778
complement(1968)-g, adbSNP:139249858
complement(2013)-t, gdbSNP:375755399
complement(2016)-g, adbSNP:201999936
complement(2029)-t, cdbSNP:372635771
complement(2048)-t, cdbSNP:369751097
complement(2065)-t, cdbSNP:386621807
2065+c, tdbSNP:9332598
2071+a, cdbSNP:6037
complement(2084)-g, adbSNP:377229795
complement(2085)-t, cdbSNP:140530655
complement(2100)-g, adbSNP:372907241
complement(2101)-t, cdbSNP:368243071
complement(2113)-t, adbSNP:377129115
complement(2136)-dbSNP:
complement(2136)-t, gdbSNP:368119979
complement(2150)-t, cdbSNP:374169951
complement(2154)-g, cdbSNP:141277663
complement(2160)-g, cdbSNP:200240938
complement(2177)-t, cdbSNP:201292247
complement(2182)-g, cdbSNP:374118662
complement(2203)-t, gdbSNP:145030674
complement(2215)-t, cdbSNP:78621730
complement(2231)-c, adbSNP:52817394
complement(2250)-g, adbSNP:78958618
complement(2264)-g, adbSNP:139222212
2272+a, gdbSNP:193920869
complement(2274)-t, cdbSNP:115954845
complement(2287)-t, cdbSNP:59779968
complement(2302)-t, cdbSNP:373181295
complement(2304)-t, cdbSNP:138254436
complement(2353)-t, cdbSNP:386601076
2353+c, tdbSNP:6016
complement(2364)-t, cdbSNP:200272546
complement(2367)-t, cdbSNP:144979314
complement(2368)-t, gdbSNP:201087308
complement(2371)-t, cdbSNP:199861733
2380+c, tdbSNP:6017
complement(2384..2386)-, ttcdbSNP:377011882
complement(2402)-t, gdbSNP:148882378
complement(2426)-t, cdbSNP:200163655
complement(2434)-t, cdbSNP:6024
2446+a, gdbSNP:6021
complement(2460)-g, adbSNP:373473212
complement(2481)-g, adbSNP:368393190
complement(2484)-g, adbSNP:200146772
2488+g, tdbSNP:13306350
complement(2512)-g, adbSNP:376662139
complement(2518)-, adbSNP:35478242
complement(2528)-g, cdbSNP:374379051
complement(2536)-g, adbSNP:139113111
complement(2539)-g, adbSNP:376357687
2546+c, tdbSNP:118203908
complement(2551)-t, cdbSNP:142101089
complement(2570)-t, cdbSNP:6031
complement(2570)-g, adbSNP:386601164
complement(2572)-t, cdbSNP:139014843
complement(2589)-t, cdbSNP:372031263
complement(2595)-t, gdbSNP:6018
complement(2607)-t, adbSNP:367867100
complement(2687)-g, adbSNP:375248946
complement(2702)-t, cdbSNP:371753182
2718+a, gdbSNP:4524
complement(2718)-t, cdbSNP:386593571
2739+a, gdbSNP:4525
complement(2745)-c, adbSNP:147637586
complement(2750)-t, gdbSNP:148829900
complement(2776)-t, cdbSNP:145436688
complement(2813)-c, adbSNP:146917786
complement(2844)-t, gdbSNP:367658863
complement(2857)-c, adbSNP:146379062
complement(2858)-t, cdbSNP:140110833
complement(2864)-g, adbSNP:373814225
complement(2880)-c, adbSNP:201040236
complement(2888)-t, adbSNP:9332695
complement(2888)-t, adbSNP:386429315
complement(2889)-g, adbSNP:144673784
complement(2897)-g, adbSNP:149389480
2918+a, gdbSNP:6032
complement(2951)-g, cdbSNP:138086769
complement(2980)-t, cdbSNP:370927080
complement(2990)-c, adbSNP:140363430
complement(2998)-g, adbSNP:368663816
complement(3009)-c, adbSNP:199507543
complement(3013)-g, adbSNP:149067268
complement(3021)-t, adbSNP:370781832
complement(3026)-c, adbSNP:377398506
complement(3028)-g, adbSNP:144026312
complement(3042)-g, adbSNP:370330489
complement(3044)-t, cdbSNP:146594078
complement(3051)-g, adbSNP:9332604
complement(3068)-g, adbSNP:199734164
complement(3070)-g, adbSNP:41272457
complement(3083)-g, adbSNP:201768061
complement(3084)-t, gdbSNP:9332605
complement(3088)-g, adbSNP:373325652
complement(3143)-t, cdbSNP:189543871
complement(3183)-t, cdbSNP:369790277
complement(3185)-t, cdbSNP:138125042
complement(3192)-t, cdbSNP:199662215
complement(3217)-t, cdbSNP:376972850
complement(3296)-g, adbSNP:149337097
complement(3307)-t, gdbSNP:149026031
3331..3332+, adbSNP:386834226
complement(3356)-g, adbSNP:146408488
complement(3365)-t, cdbSNP:369568295
complement(3366)-t, cdbSNP:200269019
complement(3384)-g, adbSNP:376579337
complement(3388)-g, adbSNP:140281633
3400+a, c, gdbSNP:6006
complement(3402)-g, adbSNP:116407347
complement(3456)-t, gdbSNP:188882337
complement(3470)-t, cdbSNP:148594463
complement(3473)-g, cdbSNP:374090395
complement(3509)-g, adbSNP:185270765
complement(3536)-g, adbSNP:371564573
complement(3547)-t, gdbSNP:373880789
complement(3548)-g, cdbSNP:149844576
complement(3583)-g, cdbSNP:6005
complement(3587)-g, adbSNP:369276714
complement(3612)-g, adbSNP:150779589
complement(3620)-g, adbSNP:148238652
complement(3623)-g, cdbSNP:144144554
3626+c, tdbSNP:118203909
complement(3627)-t, cdbSNP:368369078
complement(3630)-t, cdbSNP:371330185
3649+a, cdbSNP:13306332
complement(3667)-g, cdbSNP:367843000
complement(3681)-t, cdbSNP:201388299
complement(3689)-t, adbSNP:192773163
complement(3699)-t, adbSNP:189761035
complement(3707)-g, cdbSNP:374547794
complement(3727)-t, cdbSNP:386561700
3727+c, tdbSNP:2228668
complement(3745)-g, adbSNP:201982111
complement(3767)-g, adbSNP:184438605
complement(3776)-t, cdbSNP:140303718
complement(3802)-g, cdbSNP:372887541
complement(3813)-t, gdbSNP:200363980
complement(3835)-g, adbSNP:201491184
complement(3847)-g, adbSNP:368295218
complement(3849..3850)-, cdbSNP:35373990
complement(3870)-g, cdbSNP:370532797
complement(3881)-g, adbSNP:139352556
complement(3884)-t, cdbSNP:202098630
complement(3890)-t, gdbSNP:113465470
complement(3902)-g, adbSNP:200868808
complement(3921)-t, gdbSNP:150104888
3949+c, tdbSNP:1800594
complement(3958)-g, adbSNP:377599416
complement(3971)-t, gdbSNP:140018525
complement(3977)-g, cdbSNP:374687606
complement(3989..3990)-, gdbSNP:34772474
complement(3990)-t, cdbSNP:143333036
complement(3996)-g, adbSNP:139573207
3998+a, cdbSNP:1046712
complement(4011)-g, adbSNP:113916983
complement(4054)-g, cdbSNP:368452320
complement(4093)-g, adbSNP:9287090
complement(4094)-t, cdbSNP:149048805
complement(4106)-t, gdbSNP:112331368
complement(4113)-g, adbSNP:191150742
4125+a, gdbSNP:1800595
complement(4133)-t, gdbSNP:113604388
complement(4145)-g, adbSNP:147741798
complement(4159)-g, cdbSNP:200034607
complement(4202)-t, cdbSNP:376610549
complement(4209)-g, adbSNP:200697889
complement(4227)-g, adbSNP:200676405
complement(4239)-g, adbSNP:375043835
4240+c, tdbSNP:9332607
complement(4252)-t, gdbSNP:200762526
complement(4267)-g, cdbSNP:201452520
complement(4271)-g, adbSNP:199739353
4334+c, tdbSNP:13306334
4355+c, tdbSNP:9332608
complement(4355)-g, adbSNP:386621808
complement(4364)-t, cdbSNP:141802660
complement(4371)-c, adbSNP:150507174
complement(4414)-g, adbSNP:148002488
complement(4435)-g, adbSNP:200497509
complement(4449)-t, cdbSNP:187800927
complement(4451)-t, cdbSNP:201279941
complement(4454)-t, adbSNP:115148599
complement(4478)-t, cdbSNP:200204656
complement(4491)-g, adbSNP:113768654
complement(4492)-t, cdbSNP:145732153
complement(4495..4496)-, tdbSNP:35866019
complement(4508)-c, adbSNP:141008577
complement(4542)-t, gdbSNP:183082585
complement(4550)-g, adbSNP:144262027
complement(4572)-t, gdbSNP:373156285
complement(4641)-t, cdbSNP:144749395
complement(4654)-t, cdbSNP:139307328
complement(4692)-c, adbSNP:56872536
complement(4699)-g, adbSNP:142242259
complement(4708)-g, adbSNP:113997556
complement(4713)-g, adbSNP:187520391
4734+a, cdbSNP:6007
complement(4734)-c, adbSNP:386601025
complement(4735)-t, cdbSNP:112251127
complement(4775)-c, adbSNP:139288793
complement(4782)-t, cdbSNP:200308026
complement(4786)-g, adbSNP:138504020
complement(4805)-t, cdbSNP:369088927
complement(4809)-c, adbSNP:372266158
complement(4821)-t, cdbSNP:201931929
complement(4938)-t, cdbSNP:370805678
complement(4958)-dbSNP:
complement(4958)-g, cdbSNP:201640368
complement(4980)-t, adbSNP:141589936
complement(4988)-g, adbSNP:143397427
complement(4990)-g, adbSNP:368941592
complement(4999)-t, gdbSNP:368886239
complement(5017)-g, adbSNP:200569225
complement(5068)-g, adbSNP:116809837
complement(5121)-dbSNP:
complement(5121)-t, cdbSNP:368401109
complement(5137)-t, adbSNP:375249890
complement(5139)-t, gdbSNP:374124232
complement(5145)-g, adbSNP:200157005
complement(5164)-g, adbSNP:373570992
5167+a, gdbSNP:6010
complement(5185)-t, adbSNP:182346302
5199+c, gdbSNP:6011
complement(5204)-t, cdbSNP:201556325
complement(5269)-g, adbSNP:199568344
complement(5291)-t, adbSNP:146740336
complement(5294)-t, cdbSNP:376296101
complement(5321)-g, adbSNP:202197877
complement(5322)-t, cdbSNP:369516642
5334+a, gdbSNP:118203907
complement(5379)-dbSNP:
complement(5379)-g, adbSNP:200440114
5390+c, gdbSNP:6034
complement(5404)-t, cdbSNP:80293134
complement(5410)-t, cdbSNP:41272455
5435+a, gdbSNP:6030
complement(5453)-t, cdbSNP:374815777
complement(5510)-g, adbSNP:201790842
complement(5515)-t, adbSNP:373101677
5537+a, gdbSNP:386834227
complement(5576)-dbSNP:
complement(5576)-t, adbSNP:138877178
complement(5591)-g, adbSNP:141977229
complement(5599)-t, cdbSNP:145637633
5605+a, gdbSNP:6026
complement(5635)-t, cdbSNP:149092241
complement(5642)-t, cdbSNP:144977031
complement(5647)-g, adbSNP:141434073
complement(5648)-t, cdbSNP:144182527
complement(5666)-t, cdbSNP:142537705
complement(5679)-t, cdbSNP:200865371
complement(5680)-g, adbSNP:372920179
complement(5703)-c, adbSNP:182566496
complement(5734)-t, gdbSNP:148772659
complement(5766)-dbSNP:
complement(5766)-g, adbSNP:377129476
complement(5795)-g, adbSNP:371625729
5813+a, gdbSNP:386834228
complement(5825)-t, cdbSNP:368064025
complement(5838)-g, adbSNP:367819569
complement(5839)-t, cdbSNP:112493466
complement(5868)-dbSNP:
complement(5868)-t, cdbSNP:191148130
complement(5874)-g, adbSNP:200805004
complement(5916)-t, adbSNP:200160886
complement(5934)-dbSNP:
complement(5934)-t, cdbSNP:377182698
complement(6008)-c, adbSNP:372998280
complement(6059)-dbSNP:
complement(6059)-t, cdbSNP:376078482
complement(6068)-g, cdbSNP:146312772
complement(6094)-g, adbSNP:146120992
complement(6222)-dbSNP:
complement(6222)-g, adbSNP:111378457
complement(6308)-g, adbSNP:199690772
complement(6341)-dbSNP:
complement(6341)-g, adbSNP:376834131
complement(6342)-t, cdbSNP:369317367
complement(6361)-t, cdbSNP:148045855
complement(6386)-g, cdbSNP:201142225
complement(6403)-t, cdbSNP:200435082
complement(6404)-g, adbSNP:201709883
complement(6439)-g, adbSNP:112171464
6449+c, tdbSNP:118203910
complement(6453)-g, adbSNP:202227122
complement(6454)-t, cdbSNP:35369423
complement(6467)-g, adbSNP:200646894
complement(6472)-t, cdbSNP:267598156
complement(6529)-dbSNP:
complement(6529)-g, cdbSNP:377723406
complement(6546)-g, adbSNP:199601865
complement(6547)-t, cdbSNP:144486119
complement(6588)-t, cdbSNP:9332701
complement(6588)-g, adbSNP:386621842
complement(6597)-t, cdbSNP:201920792
complement(6605)-t, gdbSNP:200777907
complement(6634)-t, cdbSNP:138021584
complement(6669)-t, cdbSNP:369720229
complement(6681)-dbSNP:
complement(6681)-t, gdbSNP:200126811
complement(6699)-t, cdbSNP:6679078
complement(6734)-t, cdbSNP:372005449
complement(6745)-g, adbSNP:142201768
complement(6751)-t, adbSNP:368496361
complement(6755)-t, cdbSNP:371325155
complement(6783)-g, adbSNP:199629447
6810+a, gdbSNP:6027
complement(6810)-g, adbSNP:386601140
complement(6823)-g, adbSNP:369277086
complement(6825)-t, cdbSNP:374656399
complement(6849)-t, cdbSNP:367858149
complement(6859)-t, cdbSNP:375494323
complement(7022)-c, adbSNP:370721761
complement(7036)-t, adbSNP:186962725
complement(7103)-g, adbSNP:368526761
complement(7108)-g, adbSNP:116921763
complement(7183)-c, adbSNP:115882472
complement(7196)-t, adbSNP:76510731
complement(7216)-t, gdbSNP:181328696
complement(7261)-g, adbSNP:188490117
complement(7296)-g, adbSNP:72708017
complement(7301)-g, adbSNP:75302539
complement(7374)-g, adbSNP:183726377
complement(7401)-t, gdbSNP:180742904
complement(7471)-, cdbSNP:200174120
complement(7537)-t, cdbSNP:189357543
complement(7550)-t, gdbSNP:185378646
complement(7658)-g, adbSNP:376103455
7693+c, tdbSNP:9332673
7711+a, gdbSNP:9332674
complement(7733..7734)-, gdbSNP:35086892
complement(7891)-t, gdbSNP:386467403
complement(7891)-c, adbSNP:114322489
complement(7921)-c, adbSNP:188534160
complement(7935)-g, adbSNP:2040444
7938+a, gdbSNP:9332675
complement(7952)-t, cdbSNP:185213313
complement(7990)-t, cdbSNP:191866237
8066+c, tdbSNP:9332676
8110+a, gdbSNP:9332677
8256+a, tdbSNP:9332678
complement(8308)-g, adbSNP:75764442
complement(8382)-t, cdbSNP:369460775
complement(8421)-g, adbSNP:2187952
complement(8481)-t, cdbSNP:146583054
complement(8554)-t, gdbSNP:372473794
complement(8640)-t, gdbSNP:72708013
complement(8677)-g, cdbSNP:145683103
complement(8745)-g, cdbSNP:148988474
complement(8813)-, cdbSNP:369737007
complement(8843)-c, adbSNP:145812037
complement(8968)-g, cdbSNP:369159875
complement(9089)-t, cdbSNP:371085037
complement(9148)-g, cdbSNP:6427196
Gene SymbolF5
Gene SynonymFVL; PCCF; RPRGL1; THPH2
Chromosome1
Locus Map1q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000130 Homo sapiens coagulation factor V (proaccelerin, labile factor) (F5), mRNA. On-demand TBD TBD
Title Phosphatidylserine and FVa regulate FXa structure .
Author Srivasatava KR, Majumder R, Kane WH, Quinn-Allen MA and Lentz BR.
Journal Biochem. J. 459 (1), 229-239 (2014)
Title Peripartum thromboprophylaxis for homozygous and heterozygous FVL mutation carriers yields similar pregnancy outcome .
Author Gat,I., Dulitzki,M., Schiff,E., Sivan,E. and Simchen,M.J.
Journal Isr. Med. Assoc. J. 16 (2), 96-100 (2014)
Title Amino acid region 1000-1008 of factor V is a dynamic regulator for the emergence of procoagulant activity .
Author Wiencek JR, Na M, Hirbawi J and Kalafatis M.
Journal J. Biol. Chem. 288 (52), 37026-37038 (2013)
Title [The detection of Leiden mutation using technique of enzymatic extension of allele-specific primer with double bioluminescent detection (PED-Biolum)] .
Author Krasitskaia,V.V., Subbotina,T.N., Ol'khovskii,I.A. and Frank,L.A.
Journal Klin. Lab. Diagn. 12, 26 (2013)
Title Mesenteric vein thrombosis in a patient heterozygous for factor V Leiden and G20210A prothrombin genotypes .
Author Karmacharya P, Aryal MR and Donato A.
Journal World J. Gastroenterol. 19 (43), 7813-7815 (2013)
Title Factor V Leiden Thrombophilia .
Author Kujovich,J.L.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Structure of the gene for human coagulation factor V .
Author Cripe LD, Moore KD and Kane WH.
Journal Biochemistry 31 (15), 3777-3785 (1992)
Title A novel functional assay of protein C in human plasma and its comparison with amidolytic and anticoagulant assays .
Author Guglielmone HA and Vides MA.
Journal Thromb. Haemost. 67 (1), 46-49 (1992)
Title Sulfation of tyrosine residues in coagulation factor V .
Author Hortin GL.
Journal Blood 76 (5), 946-952 (1990)
Title Prothrombinase complex assembly. Contributions of protein-protein and protein-membrane interactions toward complex formation .
Author Krishnaswamy S.
Journal J. Biol. Chem. 265 (7), 3708-3718 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.