• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens coagulation factor V (proaccelerin, labile factor) (F5), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000130 Homo sapiens coagulation factor V (proaccelerin, labile factor) (F5), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000130.4, 119395710
Length 9179 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens coagulation factor V (proaccelerin, labile factor) (F5), mRNA.
Product coagulation factor V precursor
Comment

Summary: This gene encodes an essential cofactor of the blood coagulation cascade. This factor circulates in plasma, and is converted to the active form by the release of the activation peptide by thrombin during coagulation. This generates a heavy chain and a light chain which are held together by calcium ions. The activated protein is a cofactor that participates with activated coagulation factor X to activate prothrombin to thrombin. Defects in this gene result in either an autosomal recessive hemorrhagic diathesis or an autosomal dominant form of thrombophilia, which is known as activated protein C resistance. [provided by RefSeq, Oct 2008].

RefSeq NP_000121.2
CDS 146..6820
Misc Feature(1)80..82
Misc Feature(2)80..82
Misc Feature(3)230..2356
Misc Feature(4)398..721
Misc Feature(5)1145..1150
Misc Feature(6)1145..1147
Misc Feature(7)1250..1252
Misc Feature(8)1397..>1606
Misc Feature(9)1745..1750
Misc Feature(10)1745..1747
Misc Feature(11)1751..1753
Misc Feature(12)2063..2065
Misc Feature(13)2219..2221
Misc Feature(14)2264..2269
Misc Feature(15)2264..2266
Misc Feature(16)2354..2359
Misc Feature(17)2354..2356
Misc Feature(18)2357..4864
Misc Feature(19)2684..2686
Misc Feature(20)3209..3214
Misc Feature(21)3209..3211
Misc Feature(22)3281..3286
Misc Feature(23)3281..3283
Misc Feature(24)3803..3805
Misc Feature(25)4679..4681
Misc Feature(26)4862..4867
Misc Feature(27)4865..6817
Misc Feature(28)5069..>6031
Misc Feature(29)5072..>5296
Misc Feature(30)5252..5254
Misc Feature(31)5528..5530
Misc Feature(32)5861..6328
Misc Feature(33)5870..6325
Misc Feature(34)order(5990..5992,6086..6088,6107..6109)
Misc Feature(35)6173..6175
Misc Feature(36)6338..6808
Misc Feature(37)6347..6805
Misc Feature(38)order(6482..6484,6566..6568,6587..6589)
Misc Feature(39)6686..6688
Misc Feature(40)6770..6772
Exon (1)1..303
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (2)304..395
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (3)396..518
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (4)519..731
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (5)732..875
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (6)876..1097
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (7)1098..1263
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (8)1264..1441
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (9)1442..1541
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (10)1542..1756
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (11)1757..1907
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (12)1908..2120
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (13)2121..4941
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (14)4942..5116
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (15)5117..5353
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (16)5354..5564
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (17)5565..5744
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (18)5745..5861
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (19)5862..5933
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (20)5934..6037
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (21)6038..6193
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (22)6194..6338
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (23)6339..6490
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (24)6491..6673
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Exon (25)6674..9179
Gene:F5
Gene Synonym:FVL; PCCF; RPRGL1; THPH2
Translation MFPGCPRLWVLVVLGTSWVGWGSQGTEAAQLRQFYVAAQGISWSYRPEPTNSSLNLSVTS FKKIVYREYEPYFKKEKPQSTISGLLGPTLYAEVGDIIKVHFKNKADKPLSIHPQGIRYS KLSEGASYLDHTFPAEKMDDAVAPGREYTYEWSISEDSGPTHDDPPCLTHIYYSHENLIE DFNSGLIGPLLICKKGTLTEGGTQKTFDKQIVLLFAVFDESKSWSQSSSLMYTVNGYVNG TMPDITVCAHDHISWHLLGMSSGPELFSIHFNGQVLEQNHHKVSAITLVSATSTTANMTV GPEGKWIISSLTPKHLQAGMQAYIDIKNCPKKTRNLKKITREQRRHMKRWEYFIAAEEVI WDYAPVIPANMDKKYRSQHLDNFSNQIGKHYKKVMYTQYEDESFTKHTVNPNMKEDGILG PIIRAQVRDTLKIVFKNMASRPYSIYPHGVTFSPYEDEVNSSFTSGRNNTMIRAVQPGET YTYKWNILEFDEPTENDAQCLTRPYYSDVDIMRDIASGLIGLLLICKSRSLDRRGIQRAA DIEQQAVFAVFDENKSWYLEDNINKFCENPDEVKRDDPKFYESNIMSTINGYVPESITTL GFCFDDTVQWHFCSVGTQNEILTIHFTGHSFIYGKRHEDTLTLFPMRGESVTVTMDNVGT WMLTSMNSSPRSKKLRLKFRDVKCIPDDDEDSYEIFEPPESTVMATRKMHDRLEPEDEES DADYDYQNRLAAALGIRSFRNSSLNQEEEEFNLTALALENGTEFVSSNTDIIVGSNYSSP SNISKFTVNNLAEPQKAPSHQQATTAGSPLRHLIGKNSVLNSSTAEHSSPYSEDPIEDPL QPDVTGIRLLSLGAGEFKSQEHAKHKGPKVERDQAAKHRFSWMKLLAHKVGRHLSQDTGS PSGMRPWEDLPSQDTGSPSRMRPWKDPPSDLLLLKQSNSSKILVGRWHLASEKGSYEIIQ DTDEDTAVNNWLISPQNASRAWGESTPLANKPGKQSGHPKFPRVRHKSLQVRQDGGKSRL KKSQFLIKTRKKKKEKHTHHAPLSPRTFHPLRSEAYNTFSERRLKHSLVLHKSNETSLPT DLNQTLPSMDFGWIASLPDHNQNSSNDTGQASCPPGLYQTVPPEEHYQTFPIQDPDQMHS TSDPSHRSSSPELSEMLEYDRSHKSFPTDISQMSPSSEHEVWQTVISPDLSQVTLSPELS QTNLSPDLSHTTLSPELIQRNLSPALGQMPISPDLSHTTLSPDLSHTTLSLDLSQTNLSP ELSQTNLSPALGQMPLSPDLSHTTLSLDFSQTNLSPELSHMTLSPELSQTNLSPALGQMP ISPDLSHTTLSLDFSQTNLSPELSQTNLSPALGQMPLSPDPSHTTLSLDLSQTNLSPELS QTNLSPDLSEMPLFADLSQIPLTPDLDQMTLSPDLGETDLSPNFGQMSLSPDLSQVTLSP DISDTTLLPDLSQISPPPDLDQIFYPSESSQSLLLQEFNESFPYPDLGQMPSPSSPTLND TFLSKEFNPLVIVGLSKDGTDYIEIIPKEEVQSSEDDYAEIDYVPYDDPYKTDVRTNINS SRDPDNIAAWYLRSNNGNRRNYYIAAEEISWDYSEFVQRETDIEDSDDIPEDTTYKKVVF RKYLDSTFTKRDPRGEYEEHLGILGPIIRAEVDDVIQVRFKNLASRPYSLHAHGLSYEKS SEGKTYEDDSPEWFKEDNAVQPNSSYTYVWHATERSGPESPGSACRAWAYYSAVNPEKDI HSGLIGPLLICQKGILHKDSNMPMDMREFVLLFMTFDEKKSWYYEKKSRSSWRLTSSEMK KSHEFHAINGMIYSLPGLKMYEQEWVRLHLLNIGGSQDIHVVHFHGQTLLENGNKQHQLG VWPLLPGSFKTLEMKASKPGWWLLNTEVGENQRAGMQTPFLIMDRDCRMPMGLSTGIISD SQIKASEFLGYWEPRLARLNNGGSYNAWSVEKLAAEFASKPWIQVDMQKEVIITGIQTQG AKHYLKSCYTTEFYVAYSSNQINWQIFKGNSTRNVMYFNGNSDASTIKENQFDPPIVARY IRISPTRAYNRPTLRLELQGCEVNGCSTPLGMENGKIENKQITASSFKKSWWGDYWEPFR ARLNAQGRVNAWQAKANNNKQWLEIDLLKIKKITAIITQGCKSLSSEMYVKSYTIHYSEQ GVEWKPYRLKSSMVDKIFEGNTNTKGHVKNFFNPPIISRFIRVIPKTWNQSIALRLELFG CDIY
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(106)-g, adbSNP:41272465
complement(139)-t, cdbSNP:147121485
complement(188)-g, adbSNP:9332485
complement(251)-t, cdbSNP:147487854
complement(257)-c, adbSNP:184663825
complement(281)-g, cdbSNP:140598745
complement(327)-dbSNP:
complement(327)-c, adbSNP:148248774
complement(380)-g, adbSNP:143125998
complement(382)-t, cdbSNP:6028
complement(399)-dbSNP:
complement(399)-c, adbSNP:146656273
complement(427)-g, adbSNP:201439832
complement(433)-g, adbSNP:200217111
complement(435)-t, adbSNP:144675474
complement(464)-g, cdbSNP:6019
complement(489)-t, cdbSNP:201278820
complement(549)-dbSNP:
complement(549)-g, adbSNP:200765676
complement(550)-g, adbSNP:6029
complement(582)-t, cdbSNP:145625079
complement(584)-t, gdbSNP:118203912
complement(643)-t, cdbSNP:113249658
complement(669)-t, cdbSNP:201510575
complement(683)-t, cdbSNP:143152035
complement(697)-t, gdbSNP:6022
complement(709)-g, cdbSNP:1557573
complement(711)-g, adbSNP:141800405
complement(732)-dbSNP:
complement(732)-t, cdbSNP:145976832
complement(763)-t, cdbSNP:149072504
complement(773)-t, gdbSNP:144937515
complement(914)-dbSNP:
complement(914)-g, adbSNP:12118441
complement(930)-g, adbSNP:201865717
complement(946)-t, gdbSNP:201002212
complement(961)-t, cdbSNP:9332578
complement(970)-g, adbSNP:144375278
complement(1005)-t, gdbSNP:141847118
complement(1007)-g, adbSNP:147889072
complement(1023)-g, cdbSNP:200984834
complement(1030)-g, adbSNP:148752831
complement(1036)-g, adbSNP:139147538
complement(1060)-t, cdbSNP:141898470
complement(1115)-dbSNP:
complement(1115)-t, cdbSNP:145948938
complement(1116)-g, adbSNP:141622672
complement(1141)-t, gdbSNP:143509841
complement(1145)-g, adbSNP:118203905
complement(1146)-g, cdbSNP:118203906
complement(1166)-g, adbSNP:200532195
complement(1179)-t, cdbSNP:201078171
complement(1204)-g, cdbSNP:200531616
complement(1231)-g, adbSNP:147952496
complement(1251)-g, adbSNP:200934105
complement(1257)-g, adbSNP:201493488
complement(1303)-dbSNP:
complement(1303)-t, cdbSNP:148623862
complement(1305)-t, cdbSNP:118203911
complement(1326)-g, adbSNP:142875000
complement(1383)-g, adbSNP:6033
complement(1387)-t, cdbSNP:6035
complement(1427)-t, cdbSNP:200657450
complement(1510)-dbSNP:
complement(1510)-g, adbSNP:146035166
complement(1519)-t, cdbSNP:150708584
complement(1525)-t, cdbSNP:6015
complement(1536)-g, adbSNP:141768227
complement(1597)-dbSNP:
complement(1597)-g, cdbSNP:139213790
complement(1683)-g, adbSNP:6020
complement(1684)-t, cdbSNP:140627208
complement(1709)-g, cdbSNP:143663052
1746+a, gdbSNP:6025
complement(1861)-dbSNP:
complement(1861)-g, adbSNP:6036
complement(1921)-dbSNP:
complement(1921)-g, adbSNP:149240688
complement(1930)-t, cdbSNP:112333778
complement(1968)-g, adbSNP:139249858
complement(2016)-g, adbSNP:201999936
complement(2065)-t, cdbSNP:9332598
complement(2071)-c, adbSNP:6037
complement(2085)-t, cdbSNP:140530655
complement(2154)-dbSNP:
complement(2154)-g, cdbSNP:141277663
complement(2160)-g, cdbSNP:200240938
complement(2177)-t, cdbSNP:201292247
complement(2203)-t, gdbSNP:145030674
complement(2215)-t, cdbSNP:78621730
complement(2231)-c, adbSNP:52817394
complement(2250)-g, adbSNP:78958618
complement(2264)-g, adbSNP:139222212
complement(2272)-g, adbSNP:193920869
complement(2274)-t, cdbSNP:115954845
complement(2287)-t, cdbSNP:59779968
complement(2304)-t, cdbSNP:138254436
complement(2353)-t, cdbSNP:6016
complement(2364)-t, cdbSNP:200272546
complement(2367)-t, cdbSNP:144979314
complement(2368)-t, gdbSNP:201087308
complement(2371)-t, cdbSNP:199861733
complement(2380)-t, cdbSNP:6017
complement(2402)-t, gdbSNP:148882378
complement(2426)-t, cdbSNP:200163655
complement(2434)-t, cdbSNP:6024
complement(2446)-g, adbSNP:6021
complement(2484)-g, adbSNP:200146772
complement(2488)-t, gdbSNP:13306350
complement(2518)-, adbSNP:35478242
complement(2536)-g, adbSNP:139113111
complement(2546)-t, cdbSNP:118203908
complement(2551)-t, cdbSNP:142101089
complement(2570)-t, cdbSNP:6031
complement(2572)-t, cdbSNP:139014843
complement(2595)-t, gdbSNP:6018
complement(2718)-g, adbSNP:4524
complement(2739)-g, adbSNP:4525
complement(2745)-c, adbSNP:147637586
complement(2750)-t, gdbSNP:148829900
complement(2776)-t, cdbSNP:145436688
complement(2813)-c, adbSNP:146917786
complement(2857)-c, adbSNP:146379062
complement(2858)-t, cdbSNP:140110833
complement(2880)-c, adbSNP:201040236
complement(2888)-t, adbSNP:9332695
complement(2889)-g, adbSNP:144673784
complement(2897)-g, adbSNP:149389480
complement(2918)-g, adbSNP:6032
complement(2951)-g, cdbSNP:138086769
complement(2990)-c, adbSNP:140363430
complement(3009)-c, adbSNP:199507543
complement(3013)-g, adbSNP:149067268
complement(3028)-g, adbSNP:144026312
complement(3044)-t, cdbSNP:146594078
complement(3051)-g, adbSNP:9332604
complement(3068)-g, adbSNP:199734164
complement(3070)-g, adbSNP:41272457
complement(3083)-g, adbSNP:201768061
complement(3084)-t, gdbSNP:9332605
complement(3143)-t, cdbSNP:189543871
complement(3185)-t, cdbSNP:138125042
complement(3192)-t, cdbSNP:199662215
complement(3296)-g, adbSNP:149337097
complement(3307)-t, gdbSNP:149026031
complement(3356)-g, adbSNP:146408488
complement(3366)-t, cdbSNP:200269019
complement(3388)-g, adbSNP:140281633
complement(3400)-g, c, adbSNP:6006
complement(3402)-g, adbSNP:116407347
complement(3456)-t, gdbSNP:188882337
complement(3470)-t, cdbSNP:148594463
complement(3509)-g, adbSNP:185270765
complement(3548)-g, cdbSNP:149844576
complement(3583)-g, cdbSNP:6005
complement(3612)-g, adbSNP:150779589
complement(3620)-g, adbSNP:148238652
complement(3623)-g, cdbSNP:144144554
complement(3626)-t, cdbSNP:118203909
complement(3649)-c, adbSNP:13306332
complement(3681)-t, cdbSNP:201388299
complement(3689)-t, adbSNP:192773163
complement(3699)-t, adbSNP:189761035
complement(3727)-t, cdbSNP:2228668
complement(3745)-g, adbSNP:201982111
complement(3760)-g, adbSNP:145239148
complement(3767)-g, adbSNP:184438605
complement(3776)-t, cdbSNP:140303718
complement(3813)-t, gdbSNP:200363980
complement(3835)-g, adbSNP:201491184
complement(3849..3850)-, cdbSNP:35373990
complement(3881)-g, adbSNP:139352556
complement(3884)-t, cdbSNP:202098630
complement(3890)-t, gdbSNP:113465470
complement(3902)-g, adbSNP:200868808
complement(3921)-t, gdbSNP:150104888
complement(3946)-g, adbSNP:142462779
complement(3949)-t, cdbSNP:1800594
complement(3971)-t, gdbSNP:140018525
complement(3989..3990)-, gdbSNP:34772474
complement(3990)-t, cdbSNP:143333036
complement(3996)-g, adbSNP:139573207
complement(3998)-c, adbSNP:1046712
complement(4011)-g, adbSNP:113916983
complement(4093)-g, adbSNP:9287090
complement(4094)-t, cdbSNP:149048805
complement(4106)-t, gdbSNP:112331368
complement(4113)-g, adbSNP:191150742
complement(4125)-g, adbSNP:1800595
complement(4133)-t, gdbSNP:113604388
complement(4145)-g, adbSNP:147741798
complement(4159)-g, cdbSNP:200034607
complement(4180)-t, cdbSNP:145627172
complement(4209)-g, adbSNP:200697889
complement(4227)-g, adbSNP:200676405
complement(4240)-t, cdbSNP:9332607
complement(4252)-t, gdbSNP:200762526
complement(4267)-g, cdbSNP:201452520
complement(4271)-g, adbSNP:199739353
complement(4334)-t, cdbSNP:13306334
complement(4355)-t, cdbSNP:9332608
complement(4364)-t, cdbSNP:141802660
complement(4371)-c, adbSNP:150507174
complement(4414)-g, adbSNP:148002488
complement(4435)-g, adbSNP:200497509
complement(4449)-t, cdbSNP:187800927
complement(4451)-t, cdbSNP:201279941
complement(4454)-t, adbSNP:115148599
complement(4478)-t, cdbSNP:200204656
complement(4491)-g, adbSNP:113768654
complement(4492)-t, cdbSNP:145732153
complement(4495..4496)-, tdbSNP:35866019
complement(4508)-c, adbSNP:141008577
complement(4542)-t, gdbSNP:183082585
complement(4550)-g, adbSNP:144262027
complement(4641)-t, cdbSNP:144749395
complement(4654)-t, cdbSNP:139307328
complement(4692)-c, adbSNP:56872536
complement(4699)-g, adbSNP:142242259
complement(4708)-g, adbSNP:113997556
complement(4713)-g, adbSNP:187520391
complement(4734)-c, adbSNP:6007
complement(4735)-t, cdbSNP:112251127
complement(4775)-c, adbSNP:139288793
complement(4782)-t, cdbSNP:200308026
complement(4786)-g, adbSNP:138504020
complement(4821)-t, cdbSNP:201931929
complement(4958)-dbSNP:
complement(4958)-g, cdbSNP:201640368
complement(4980)-t, adbSNP:141589936
complement(4988)-g, adbSNP:143397427
complement(5017)-g, adbSNP:200569225
complement(5068)-g, adbSNP:116809837
complement(5145)-dbSNP:
complement(5145)-g, adbSNP:200157005
complement(5167)-g, adbSNP:6010
complement(5185)-t, adbSNP:182346302
complement(5199)-g, cdbSNP:6011
complement(5204)-t, cdbSNP:201556325
complement(5269)-g, adbSNP:199568344
complement(5291)-t, adbSNP:146740336
complement(5321)-g, adbSNP:202197877
complement(5334)-g, adbSNP:118203907
complement(5365)-dbSNP:
complement(5365)-g, adbSNP:139654548
complement(5379)-g, adbSNP:200440114
complement(5390)-g, cdbSNP:6034
complement(5404)-t, cdbSNP:80293134
complement(5410)-t, cdbSNP:41272455
complement(5435)-g, adbSNP:6030
complement(5510)-g, adbSNP:201790842
complement(5576)-dbSNP:
complement(5576)-t, adbSNP:138877178
complement(5591)-g, adbSNP:141977229
complement(5599)-t, cdbSNP:145637633
complement(5605)-g, adbSNP:6026
complement(5635)-t, cdbSNP:149092241
complement(5642)-t, cdbSNP:144977031
complement(5647)-g, adbSNP:141434073
complement(5648)-t, cdbSNP:144182527
complement(5666)-t, cdbSNP:142537705
complement(5679)-t, cdbSNP:200865371
complement(5703)-c, adbSNP:182566496
complement(5734)-t, gdbSNP:148772659
complement(5839)-dbSNP:
complement(5839)-t, cdbSNP:112493466
complement(5868)-dbSNP:
complement(5868)-t, cdbSNP:191148130
complement(5874)-g, adbSNP:200805004
complement(5916)-t, adbSNP:200160886
complement(6068)-dbSNP:
complement(6068)-g, cdbSNP:146312772
complement(6094)-g, adbSNP:146120992
complement(6222)-dbSNP:
complement(6222)-g, adbSNP:111378457
complement(6308)-g, adbSNP:199690772
complement(6361)-dbSNP:
complement(6361)-t, cdbSNP:148045855
complement(6386)-g, cdbSNP:201142225
complement(6403)-t, cdbSNP:200435082
complement(6404)-g, adbSNP:201709883
complement(6439)-g, adbSNP:112171464
complement(6449)-t, cdbSNP:118203910
complement(6453)-g, adbSNP:202227122
complement(6454)-t, cdbSNP:35369423
complement(6467)-g, adbSNP:200646894
complement(6546)-dbSNP:
complement(6546)-g, adbSNP:199601865
complement(6547)-t, cdbSNP:144486119
complement(6588)-t, cdbSNP:9332701
complement(6597)-t, cdbSNP:201920792
complement(6605)-t, gdbSNP:200777907
complement(6634)-t, cdbSNP:138021584
complement(6681)-dbSNP:
complement(6681)-t, gdbSNP:200126811
complement(6699)-t, cdbSNP:6679078
complement(6745)-g, adbSNP:142201768
complement(6783)-g, adbSNP:199629447
complement(6810)-g, adbSNP:6027
complement(7036)-t, adbSNP:186962725
complement(7108)-g, adbSNP:116921763
complement(7183)-c, adbSNP:115882472
complement(7196)-t, adbSNP:76510731
complement(7216)-t, gdbSNP:181328696
complement(7261)-g, adbSNP:188490117
complement(7296)-g, adbSNP:72708017
complement(7301)-g, adbSNP:75302539
complement(7374)-g, adbSNP:183726377
complement(7401)-t, gdbSNP:180742904
complement(7471)-, cdbSNP:200174120
complement(7537)-t, cdbSNP:189357543
complement(7550)-t, gdbSNP:185378646
complement(7693)-t, cdbSNP:9332673
complement(7711)-g, adbSNP:9332674
complement(7735..7736)-, gdbSNP:35086892
complement(7891)-c, adbSNP:114322489
complement(7921)-c, adbSNP:188534160
complement(7935)-g, adbSNP:2040444
complement(7938)-g, adbSNP:9332675
complement(7952)-t, cdbSNP:185213313
complement(7990)-t, cdbSNP:191866237
complement(8066)-t, cdbSNP:9332676
complement(8110)-g, adbSNP:9332677
complement(8256)-t, adbSNP:9332678
complement(8308)-g, adbSNP:75764442
complement(8421)-g, adbSNP:2187952
complement(8481)-t, cdbSNP:146583054
complement(8640)-t, gdbSNP:72708013
complement(8677)-g, cdbSNP:145683103
complement(8745)-g, cdbSNP:148988474
complement(8843)-c, adbSNP:145812037
complement(9148)-g, cdbSNP:6427196
Gene SymbolF5
Gene SynonymFVL; PCCF; RPRGL1; THPH2
Chromosome1
Locus Map1q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000130 Homo sapiens coagulation factor V (proaccelerin, labile factor) (F5), mRNA. On-demand TBD TBD
Title Phosphatidylserine-induced factor Xa dimerization and binding to factor Va are competing processes in solution .
Author Majumder,R., Koklic,T., Rezaie,A.R. and Lentz,B.R.
Journal Biochemistry 52 (1), 143-151 (2013)
Title Prothrombotic polymorphisms in patients with Raynaud's phenomenon and migraine .
Author Takats,A.T., Shemirani,A.H., Zsori,K.S., Andras,C. and Csiki,Z.
Journal Acta Physiol Hung 99 (4), 430-435 (2012)
Title Effect of the factor V Leiden mutation on the incidence and outcome of severe infection and sepsis .
Author Schouten,M., van 't Veer,C., van der Poll,T. and Levi,M.
Journal Neth J Med 70 (7), 306-310 (2012)
Title Polymorphisms of genes encoding coagulation factors II, V, VII, and .
Author Kopyta,I.A., Emich-Widera,E., Balcerzyk,A., Niemiec,P., Zak,I., Pilarska,E., Kacinski,M., Wendorff,J., Nowak,T., Iwanicki,T., Pienczk-Reclawowicz,K. and Palatynska,K.
Journal Neurologist 18 (5), 282-286 (2012)
Title Inherited thrombophilia with recurrent pregnancy loss in Turkish women--a real phenomenon? .
Author Yildiz,G., Yavuzcan,A., Yildiz,P., Suer,N. and Tandogan,N.
Journal Ginekol. Pol. 83 (8), 598-603 (2012)
Title Structure of the gene for human coagulation factor V .
Author Cripe,L.D., Moore,K.D. and Kane,W.H.
Journal Biochemistry 31 (15), 3777-3785 (1992)
Title A novel functional assay of protein C in human plasma and its comparison with amidolytic and anticoagulant assays .
Author Guglielmone,H.A. and Vides,M.A.
Journal Thromb. Haemost. 67 (1), 46-49 (1992)
Title Sulfation of tyrosine residues in coagulation factor V .
Author Hortin,G.L.
Journal Blood 76 (5), 946-952 (1990)
Title Prothrombinase complex assembly. Contributions of protein-protein and protein-membrane interactions toward complex formation .
Author Krishnaswamy,S.
Journal J. Biol. Chem. 265 (7), 3708-3718 (1990)
Title The roles of protein C and thrombomodulin in the regulation of blood coagulation .
Author Esmon,C.T.
Journal J. Biol. Chem. 264 (9), 4743-4746 (1989)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.