• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25846 Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu25846C Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000135.2, 66880552
Length 4368 bp
Structure linear
Update Date 24-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA.
Product Fanconi anemia group A protein isoform a
Comment

Summary: The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group A. Alternative splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are the most common cause of Fanconi anemia. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (a).

RefSeq NP_000126.2
CDS 43..4410
Misc Feature(1)94..144
Misc Feature(2)94..144
Misc Feature(3)3487..3489
Misc Feature(4)3799..3978
Misc Feature(5)4387..4389
Misc Feature(6)4387..4389
Exon (1)1..121
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (2)122..231
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (3)232..325
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (4)326..468
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (5)469..564
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (6)565..638
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (7)639..751
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (8)752..834
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (9)835..868
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (10)869..935
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (11)936..1048
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (12)1049..1125
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (13)1126..1267
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (14)1268..1401
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (15)1402..1512
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (16)1513..1608
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (17)1609..1668
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (18)1669..1757
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (19)1758..1818
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (20)1819..1868
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (21)1869..1942
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (22)1943..2056
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (23)2057..2193
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (24)2194..2264
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (25)2265..2358
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (26)2359..2546
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (27)2547..2643
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (28)2644..2820
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (29)2821..2894
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (30)2895..3023
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (31)3024..3108
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (32)3109..3281
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (33)3282..3390
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (34)3391..3450
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (35)3451..3555
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (36)3556..3668
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (37)3669..3807
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (38)3808..3870
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (39)3871..3976
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (40)3977..4052
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (41)4053..4209
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (42)4210..4302
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Exon (43)4303..5460
Gene:FANCA
Gene Synonym:FA; FA-H; FA1; FAA; FACA; FAH; FANCH
Translation MSDSWVPNSASGQDPGGRRRAWAELLAGRVKREKYNPERAQKLKESAVRLLRSHQDLNAL LLEVEGPLCKKLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS VGQICTAPAETSHPVLLTVEQRKKLSSLLEFAQYLLAHSMFSRLSFCQELWKIQSSLLLE AVWHLHVQGIVSLQELLESHPDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQ MFVLRGFQKNSDLRRTVEPEKMPQVTVDVLQRMLIFALDALAAGVQEESSTHKIVRCWFG VFSGHTLGSVISTDPLKRFFSHTLTQILTHSPVLKASDAVQMQREWSFARTHPLLTSLYR RLFVMLSAEELVGHLQEVLETQEVHWQRVLSFVSALVVCFPEAQQLLEDWVARLMAQAFE SCQLDSMVTAFLVVRQAALEGPSAFLSYADWFKASFGSTRGYHGCSKKALVFLFTFLSEL VPFESPRYLQVHILHPPLVPGKYRSLLTDYISLAKTRLADLKVSIENMGLYEDLSSAGDI TEPHSQALQDVEKAIMVFEHTGNIPVTVMEASIFRRPYYVSHFLPALLTPRVLPKVPDSR VAFIESLKRADKIPPSLYSTYCQACSAAEEKPEDAALGVRAEPNSAEEPLGQLTAALGEL RASMTDPSQRDVISAQVAVISERLRAVLGHNEDDSSVEISKIQLSINTPRLEPREHMAVD LLLTSFCQNLMAASSVAPPERQGPWAALFVRTMCGRVLPAVLTRLCQLLRHQGPSLSAPH VLGLAALAVHLGESRSALPEVDVGPPAPGAGLPVPALFDSLLTCRTRDSLFFCLKFCTAA ISYSLCKFSSQSRDTLCSCLSPGLIKKFQFLMFRLFSEARQPLSEEDVASLSWRPLHLPS ADWQRAALSLWTHRTFREVLKEEDVHLTYQDWLHLELEIQPEADALSDTERQDFHQWAIH EHFLPESSASGGCDGDLQAACTILVNALMDFHQSSRSYDHSENSDLVFGGRTGNEDIISR LQEMVADLELQQDLIVPLGHTPSQEHFLFEIFRRRLQALTSGWSVAASLQRQRELLMYKR ILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFFRGLLN ACLRSRDPSLMVDFILAKCQTKCPLILTSALVWWPSLEPVLLCRWRRHCQSPLPRELQKL QEGRQFASDFLSPEAASPAPNPDWLSAAALHFAIQQVREENIRKQLKKLDCEREELLVFL FFFSLMGLLSSHLTSNSTTDLPKAFHVCAAILECLEKRKISWLALFQLTESDLRLGRLLL RVAPDQHTRLLPFAFYSLLSYFHEDAAIREEAFLHVAVDMYLKLVQLFVAGDTSTVSPPA GRSLELKGQGNPVELITKARLFLLQLIPRCPKKSFSHVAELLADRGDCDPEVSAALQSRQ QAAPDADLSQEPHLF
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(31)-dbSNP:
complement(31)-t, cdbSNP:373256600
complement(42)-g, adbSNP:373787342
59+a, tdbSNP:1800282
complement(63)-c, adbSNP:115856189
66+c, gdbSNP:76275444
complement(101)-t, cdbSNP:376307136
complement(123)-dbSNP:
complement(123)-t, cdbSNP:150247726
complement(140)-t, cdbSNP:372857989
157+a, cdbSNP:17232091
complement(158)-t, g, cdbSNP:151089298
complement(174)-t, cdbSNP:200428379
complement(175)-c, adbSNP:142990858
complement(177)-t, cdbSNP:141820040
complement(195)-t, cdbSNP:76278570
complement(199)-t, gdbSNP:61757383
complement(211)-g, adbSNP:368828271
complement(234)-dbSNP:
complement(234)-t, cdbSNP:61749989
complement(242)-t, gdbSNP:200698961
complement(251)-t, cdbSNP:55692229
complement(267)-g, adbSNP:201901337
complement(270)-t, cdbSNP:372180286
complement(279)-g, adbSNP:144151341
complement(343)-dbSNP:
complement(343)-g, cdbSNP:140412064
complement(345)-t, cdbSNP:199552612
complement(350)-g, adbSNP:147176389
complement(380)-g, adbSNP:149903404
complement(417)-g, adbSNP:199793463
complement(419)-g, c, adbSNP:139160837
complement(427)-c, adbSNP:374945563
434+c, gdbSNP:34491278
complement(436)-t, adbSNP:371449661
complement(441)-g, adbSNP:56190097
complement(443)-g, adbSNP:143570168
complement(479)-dbSNP:
complement(479)-g, cdbSNP:141367100
complement(482)-g, adbSNP:138744489
complement(487)-c, adbSNP:372814783
complement(491)-t, adbSNP:146303624
complement(522)-t, cdbSNP:200603300
complement(530)-t, cdbSNP:375648811
complement(535)-c, adbSNP:113468465
complement(536)-g, adbSNP:141918444
complement(547)-g, cdbSNP:372691338
555+a, gdbSNP:121907930
569+dbSNP:
569+c, tdbSNP:35566151
complement(584)-t, cdbSNP:17232246
complement(584)-g, adbSNP:386543111
complement(585)-t, cdbSNP:143314367
complement(586)-t, cdbSNP:375710447
complement(600)-t, gdbSNP:149159377
complement(616)-t, gdbSNP:373948590
complement(618)-g, adbSNP:150448150
complement(619)-g, cdbSNP:141861208
complement(643)-dbSNP:
complement(643)-g, adbSNP:144917960
complement(665)-g, adbSNP:144420697
complement(703)-t, cdbSNP:150924963
complement(713)-t, gdbSNP:375173988
complement(717)-g, adbSNP:367717307
complement(721)-g, cdbSNP:142580507
complement(723)-t, adbSNP:200272755
complement(727)-t, cdbSNP:148419748
complement(730)-t, cdbSNP:144560850
complement(736)-t, gdbSNP:61757384
complement(743)-g, adbSNP:145869646
complement(763)-dbSNP:
complement(763)-t, cdbSNP:370078576
complement(796)-t, cdbSNP:111944585
complement(797)-g, adbSNP:17225943
complement(809)-t, gdbSNP:377078635
complement(817)-g, cdbSNP:200988394
complement(820)-t, cdbSNP:201992220
complement(828)-t, cdbSNP:373410450
831+a, gdbSNP:34354932
complement(838)-dbSNP:
complement(838)-t, cdbSNP:7190823
complement(843)-g, adbSNP:55660936
complement(853)-g, adbSNP:372163487
872+dbSNP:
872+c, gdbSNP:35880318
complement(899)-t, cdbSNP:13336566
complement(904)-c, adbSNP:148100796
complement(911)-t, gdbSNP:185984960
complement(914)-g, cdbSNP:200820064
complement(916)-g, cdbSNP:200220791
complement(925)-t, cdbSNP:113652135
complement(943)-dbSNP:
complement(943)-g, cdbSNP:201134867
complement(945)-c, adbSNP:56062548
complement(959)-g, adbSNP:370852532
complement(960)-t, cdbSNP:199634699
complement(966)-g, adbSNP:143255238
complement(974)-g, adbSNP:75501942
995+g, tdbSNP:72552377
complement(999)-g, cdbSNP:17226068
complement(1005)-g, adbSNP:146911226
complement(1052)-dbSNP:
complement(1052)-g, cdbSNP:374835951
complement(1088)-g, adbSNP:142620413
complement(1089)-t, cdbSNP:144900606
complement(1090)-g, adbSNP:150290184
complement(1091)-t, cdbSNP:199967286
complement(1107)-g, adbSNP:373366147
complement(1120)-g, cdbSNP:375895456
complement(1122)-g, adbSNP:372341491
1157..1160+dbSNP:
1157..1160+, ttggdbSNP:397507552
complement(1179)-t, cdbSNP:372829977
1185+g, tdbSNP:1800331
complement(1194)-c, adbSNP:151159417
complement(1196)-t, cdbSNP:143262599
complement(1225)-c, adbSNP:202062504
complement(1233)-g, adbSNP:112909352
complement(1269)-dbSNP:
complement(1269)-g, adbSNP:139944072
complement(1277)-g, adbSNP:11646374
complement(1278)-t, cdbSNP:371993688
complement(1280)-t, cdbSNP:201385829
complement(1321)-t, cdbSNP:368103890
complement(1332)-g, adbSNP:1800332
complement(1345)-g, adbSNP:148473140
complement(1355)-g, adbSNP:376882580
complement(1364)-t, cdbSNP:371716550
complement(1370)-g, cdbSNP:367733447
complement(1373)-g, adbSNP:144234991
complement(1374)-t, cdbSNP:377705748
complement(1382)-g, adbSNP:149551759
complement(1400)-t, cdbSNP:139248966
complement(1402)-dbSNP:
complement(1402)-c, adbSNP:150863702
complement(1413)-c, adbSNP:369988875
complement(1414)-t, adbSNP:373341058
complement(1455)-g, adbSNP:201561753
complement(1501)-g, adbSNP:143083764
complement(1502)-t, cdbSNP:377637236
complement(1520)-dbSNP:
complement(1520)-g, adbSNP:113042003
complement(1542)-g, adbSNP:139276494
complement(1543)-t, cdbSNP:2239359
complement(1552)-t, gdbSNP:200291237
complement(1579)-g, adbSNP:144118098
complement(1636)-dbSNP:
complement(1636)-t, cdbSNP:374490484
complement(1676)-dbSNP:
complement(1676)-c, adbSNP:200922390
complement(1691..1693)-, catdbSNP:199697625
complement(1717)-t, cdbSNP:201323171
complement(1724)-g, cdbSNP:148154682
complement(1725)-t, cdbSNP:143451067
complement(1737)-t, adbSNP:139181196
complement(1752)-g, c, adbSNP:17226344
complement(1792)-dbSNP:
complement(1792)-g, cdbSNP:145459403
complement(1797)-g, cdbSNP:144704750
complement(1798)-t, cdbSNP:201212806
complement(1847)-g, adbSNP:374968669
complement(1870)-dbSNP:
complement(1870)-t, cdbSNP:192541465
complement(1872)-g, adbSNP:1800338
complement(1913)-g, adbSNP:146491000
complement(1916)-g, cdbSNP:139235751
complement(1921)-g, cdbSNP:139203712
complement(1926)-g, adbSNP:200686934
complement(1927)-c, adbSNP:201894526
complement(1931)-t, adbSNP:199599499
complement(1943)-dbSNP:
complement(1943)-t, cdbSNP:151232042
complement(1944)-c, adbSNP:187300458
complement(1946)-g, adbSNP:142217479
1969+c, gdbSNP:17232910
complement(1970)-g, cdbSNP:34592408
complement(1983)-g, adbSNP:17232917
complement(1987)-, gdbSNP:34413183
complement(1987)-g, adbSNP:370284758
complement(1993)-t, cdbSNP:140785340
complement(2001)-g, adbSNP:368643963
complement(2019)-g, cdbSNP:374452855
complement(2041)-g, adbSNP:147300317
complement(2045)-t, cdbSNP:182288490
complement(2063)-dbSNP:
complement(2063)-t, cdbSNP:17232973
complement(2063)-t, cdbSNP:386543115
complement(2064)-t, cdbSNP:371997754
complement(2097)-t, cdbSNP:374026230
complement(2114)-t, cdbSNP:367880372
complement(2122)-t, cdbSNP:201589909
complement(2130)-g, adbSNP:150917432
complement(2131)-t, cdbSNP:376888740
complement(2136)-g, cdbSNP:201672093
complement(2141)-g, adbSNP:113436495
complement(2143)-t, cdbSNP:56369086
complement(2151)-g, cdbSNP:371458363
complement(2166)-t, cdbSNP:201668358
complement(2168)-g, adbSNP:148203537
complement(2182)-g, cdbSNP:200284845
complement(2193)-t, gdbSNP:1131660
complement(2252)-dbSNP:
complement(2252)-g, adbSNP:199938598
2258+c, tdbSNP:45441106
complement(2303)-dbSNP:
complement(2303)-g, cdbSNP:377475477
complement(2309)-g, cdbSNP:137913973
complement(2317)-g, adbSNP:145334278
complement(2318)-g, adbSNP:373147908
complement(2319)-c, adbSNP:370053960
complement(2333)-t, cdbSNP:377442601
complement(2334)-t, cdbSNP:56267906
complement(2351)-t, cdbSNP:145552439
complement(2406)-dbSNP:
complement(2406)-g, adbSNP:149754397
complement(2432)-g, adbSNP:138248569
complement(2433)-t, cdbSNP:147882314
complement(2462)-g, adbSNP:144570744
complement(2467)-g, cdbSNP:200287261
complement(2468)-t, cdbSNP:7195066
complement(2474)-t, cdbSNP:201152989
complement(2520)-t, cdbSNP:147283549
complement(2549)-dbSNP:
complement(2549)-t, adbSNP:142869950
complement(2569)-c, adbSNP:374030577
complement(2591)-t, gdbSNP:77805547
complement(2609)-g, adbSNP:370085403
complement(2616)-g, cdbSNP:17233141
complement(2631)-t, gdbSNP:72807571
complement(2652)-dbSNP:
complement(2652)-g, adbSNP:201160735
complement(2670)-g, adbSNP:368987148
complement(2678)-g, cdbSNP:375919830
complement(2679)-g, adbSNP:149435806
complement(2681)-t, cdbSNP:372254398
complement(2682)-c, adbSNP:200782529
complement(2700)-g, cdbSNP:139002130
complement(2703)-g, adbSNP:145941808
complement(2730)-t, cdbSNP:142393744
complement(2744)-g, adbSNP:137880366
complement(2777)-g, adbSNP:376302719
complement(2797)-c, adbSNP:150330232
complement(2798)-g, adbSNP:202131468
complement(2819)-t, cdbSNP:368730990
complement(2841)-dbSNP:
complement(2841)-t, cdbSNP:148250597
complement(2854)-g, cdbSNP:376106733
complement(2885)-t, gdbSNP:193172749
complement(2898)-dbSNP:
complement(2898)-g, cdbSNP:200093209
complement(2901)-g, cdbSNP:149112292
complement(2916)-t, cdbSNP:199916178
complement(2919)-g, adbSNP:369548782
complement(2929)-g, adbSNP:372804274
complement(2936)-g, cdbSNP:200517482
2943+c, tdbSNP:17226980
complement(2965)-t, cdbSNP:369565161
complement(2983)-g, adbSNP:191943709
complement(2989)-t, adbSNP:375312389
complement(2990)-g, adbSNP:144681625
complement(2991)-c, adbSNP:188695241
complement(3000)-g, adbSNP:368953287
complement(3017)-t, adbSNP:184007986
complement(3019)-t, gdbSNP:140823801
complement(3053)-dbSNP:
complement(3053)-t, cdbSNP:45501101
complement(3068)-g, cdbSNP:202073350
complement(3073)-g, adbSNP:142377616
complement(3074)-t, cdbSNP:200022826
complement(3087)-g, cdbSNP:147661788
complement(3111)-dbSNP:
complement(3111)-c, adbSNP:373986283
3129+a, gdbSNP:35402142
complement(3141)-t, gdbSNP:139289675
complement(3156)-g, adbSNP:55758861
complement(3180)-g, adbSNP:150884376
complement(3196)-g, adbSNP:367820147
complement(3198)-g, cdbSNP:373305027
complement(3199)-g, adbSNP:376103033
complement(3200)-t, cdbSNP:371351450
complement(3203)-g, cdbSNP:199570931
complement(3210)-g, adbSNP:377633991
complement(3211)-t, gdbSNP:373545111
complement(3215)-g, adbSNP:370873098
complement(3223)-t, cdbSNP:369878171
3225+c, tdbSNP:1800346
complement(3226)-t, cdbSNP:142379991
complement(3235)-t, cdbSNP:140124051
3240+c, tdbSNP:17227071
complement(3268)-g, cdbSNP:368921238
3295+dbSNP:
3295+c, tdbSNP:35283355
complement(3302)-g, adbSNP:376089640
complement(3303)-t, cdbSNP:139126509
complement(3305)-t, cdbSNP:17233497
complement(3305)-g, adbSNP:386543118
complement(3391)-dbSNP:
complement(3391)-t, cdbSNP:149277003
complement(3394)-t, cdbSNP:371208490
complement(3401)-g, cdbSNP:370731587
complement(3432)-g, adbSNP:373168838
complement(3441)-g, cdbSNP:369979902
complement(3454)-dbSNP:
complement(3454)-g, cdbSNP:138417003
complement(3462)-g, adbSNP:369765552
complement(3469)-g, cdbSNP:61753269
complement(3471)-t, cdbSNP:146062039
complement(3472)-g, adbSNP:143671872
complement(3473)-t, cdbSNP:138112218
complement(3476)-t, cdbSNP:375630115
complement(3479)-g, cdbSNP:199589419
complement(3490)-g, adbSNP:369073173
complement(3524)-t, g, adbSNP:142833057
complement(3546)-t, gdbSNP:371464360
complement(3566)-dbSNP:
complement(3566)-g, adbSNP:147017625
complement(3578)-g, cdbSNP:141422170
complement(3580)-t, cdbSNP:372706571
complement(3592)-g, adbSNP:201492940
complement(3593)-g, cdbSNP:147672303
complement(3604)-g, adbSNP:372449817
complement(3625)-g, adbSNP:143642304
complement(3626)-t, cdbSNP:138013482
complement(3633)-t, cdbSNP:55773634
complement(3657)-t, cdbSNP:368349576
complement(3666)-g, adbSNP:149797103
complement(3673)-dbSNP:
complement(3673)-g, adbSNP:140143192
complement(3679)-g, cdbSNP:200713354
complement(3686)-t, gdbSNP:199601218
3696+a, gdbSNP:1800358
complement(3707)-g, adbSNP:374537936
complement(3711)-g, adbSNP:187074190
complement(3735)-g, adbSNP:144524132
complement(3741)-t, cdbSNP:371798854
complement(3756)-t, cdbSNP:368437504
complement(3760)-g, cdbSNP:150719428
complement(3765)-g, adbSNP:202107465
complement(3802)-t, cdbSNP:375700263
complement(3806)-t, gdbSNP:373998809
3830..3832+dbSNP:
3830..3832+, tctdbSNP:397507553
complement(3834)-g, adbSNP:141128234
complement(3843)-g, adbSNP:143772894
complement(3844)-g, adbSNP:143982249
complement(3849)-g, cdbSNP:11649210
complement(3852)-t, cdbSNP:138144828
complement(3862)-t, cdbSNP:115431604
complement(3878)-dbSNP:
complement(3878)-t, gdbSNP:192188499
complement(3887)-g, cdbSNP:370949960
complement(3890)-t, cdbSNP:146975341
complement(3892)-t, cdbSNP:142919010
complement(3898)-g, adbSNP:200917877
complement(3899)-t, gdbSNP:138620653
complement(3901)-g, adbSNP:17227354
complement(3933)-g, adbSNP:17227361
complement(3939)-t, cdbSNP:151241802
complement(3991)-dbSNP:
complement(3991)-g, adbSNP:200215131
complement(3992)-t, cdbSNP:376523966
complement(3996)-g, cdbSNP:187297609
complement(4004)-t, cdbSNP:374649848
complement(4013)-g, adbSNP:182657062
complement(4023)-g, adbSNP:141278771
4024+a, gdbSNP:9282681
complement(4057)-dbSNP:
complement(4057)-g, adbSNP:149775657
complement(4061)-g, adbSNP:112734327
complement(4065)-g, adbSNP:201740587
4077+c, tdbSNP:17227389
complement(4078)-t, cdbSNP:386543092
complement(4078)-g, adbSNP:17227396
complement(4079)-g, adbSNP:201886956
complement(4106)-t, adbSNP:145886270
complement(4146)-g, adbSNP:375237681
complement(4147)-t, cdbSNP:201225325
complement(4172)-g, cdbSNP:199599393
complement(4177)-t, gdbSNP:372493612
complement(4187)-g, cdbSNP:367970303
complement(4219)-dbSNP:
complement(4219)-t, cdbSNP:199652831
complement(4241)-t, cdbSNP:149851163
complement(4267)-g, adbSNP:139478274
complement(4268)-t, cdbSNP:370507983
complement(4274)-g, adbSNP:201494304
complement(4275)-t, cdbSNP:368985041
complement(4286)-c, adbSNP:201658945
complement(4291)-g, cdbSNP:17227403
complement(4294)-t, cdbSNP:145148206
complement(4296)-g, cdbSNP:200284171
complement(4313)-dbSNP:
complement(4313)-t, cdbSNP:139532591
complement(4316)-t, cdbSNP:147406377
4317+c, tdbSNP:3743863
complement(4326)-g, adbSNP:367630825
complement(4342)-t, cdbSNP:374984587
complement(4344)-g, adbSNP:142784426
complement(4345)-t, cdbSNP:74977201
complement(4350)-g, adbSNP:199937973
complement(4367)-g, cdbSNP:144171225
complement(4371)-g, adbSNP:371228419
4372+c, gdbSNP:17233783
complement(4374)-c, adbSNP:149531696
complement(4377)-g, adbSNP:374830555
complement(4411)-g, adbSNP:370357192
complement(4415)-t, gdbSNP:199675569
complement(4444)-t, cdbSNP:190645652
complement(4453)-t, cdbSNP:368670194
complement(4460)-t, cdbSNP:145495509
complement(4511..4513)-, gagdbSNP:367986996
complement(4514)-t, cdbSNP:55859244
complement(4519)-g, adbSNP:55679217
complement(4525)-g, adbSNP:147195004
complement(4552)-g, cdbSNP:186497529
4557+a, gdbSNP:141761812
4564+a, gdbSNP:1230
complement(4564)-t, cdbSNP:386523676
complement(4575)-g, adbSNP:181842476
complement(4641)-g, adbSNP:190762834
complement(4659)-g, adbSNP:56049032
complement(4662)-g, cdbSNP:17233797
complement(4696)-t, cdbSNP:17233804
complement(4696)-g, adbSNP:386543119
complement(4697)-g, adbSNP:17227417
complement(4714)-g, adbSNP:370868774
complement(4718)-g, adbSNP:112177258
complement(4719)-t, gdbSNP:56346328
complement(4724)-t, cdbSNP:200757877
complement(4727)-t, cdbSNP:201817705
complement(4744)-t, adbSNP:374939326
complement(4745)-t, cdbSNP:199528837
complement(4748)-g, adbSNP:148487227
complement(4777)-t, cdbSNP:200745032
complement(4786)-g, adbSNP:56006529
complement(4787)-t, cdbSNP:55830337
complement(4794)-t, gdbSNP:141300146
complement(4795)-g, cdbSNP:17227424
complement(4805)-t, adbSNP:370135143
4808+a, gdbSNP:17227431
complement(4810)-t, cdbSNP:145686036
complement(4816)-g, adbSNP:377737268
complement(4822)-g, cdbSNP:201151160
complement(4876)-g, adbSNP:375543372
complement(4878)-g, cdbSNP:140576598
complement(4885)-g, cdbSNP:200903461
complement(4931)-g, adbSNP:144644592
complement(4969)-g, adbSNP:142475962
complement(4985)-g, adbSNP:201383247
complement(5053)-t, cdbSNP:370763750
complement(5064)-t, cdbSNP:17227438
complement(5064)-t, cdbSNP:386543093
complement(5065)-t, cdbSNP:373907040
complement(5070)-g, adbSNP:144483660
complement(5072)-t, gdbSNP:4399534
5080+g, tdbSNP:17233812
5082+a, gdbSNP:17233819
complement(5082)-, cdbSNP:66471129
complement(5083..5084)-, ctdbSNP:201727980
5083+a, c, g, tdbSNP:62704561
5083+, a, g, ggdbSNP:17233826
complement(5089)-t, gdbSNP:17233833
complement(5089)-c, adbSNP:386543121
complement(5089)-, adbSNP:375657470
complement(5093)-t, cdbSNP:376007349
complement(5101)-g, cdbSNP:372441703
complement(5108)-g, adbSNP:368947676
complement(5135)-g, adbSNP:374057605
complement(5144)-t, cdbSNP:369592437
complement(5158)-g, cdbSNP:149209309
complement(5183)-t, cdbSNP:138414698
complement(5215)-c, adbSNP:199778951
complement(5229)-g, adbSNP:186050933
complement(5230)-g, cdbSNP:200396402
complement(5234)-t, cdbSNP:369086041
complement(5246)-g, adbSNP:377568154
complement(5253)-g, adbSNP:201316239
complement(5256)-t, cdbSNP:371468362
complement(5347)-t, c, adbSNP:55794507
complement(5387)-g, adbSNP:181463391
complement(5396)-t, cdbSNP:16966023
complement(5421)-t, cdbSNP:17227452
Gene SymbolFANCA
Gene SynonymFA; FA-H; FA1; FAA; FACA; FAH; FANCH
Chromosome16
Locus Map16q24.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000135 Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA. On-demand $1699.00 25
NM_000135 Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA. On-demand $1699.00 25
NM_000135 Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA. On-demand $1699.00 25
NM_000135 Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA. On-demand $1699.00 25
NM_000135 Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA. On-demand $1699.00 25
NM_000135 Homo sapiens Fanconi anemia, complementation group A (FANCA), transcript variant 1, mRNA. On-demand $1699.00 25
Title Epigenetic silencing of MicroRNA-503 regulates FANCA expression in non-small cell lung cancer cell .
Author Li N, Zhang F, Li S and Zhou S.
Journal Biochem. Biophys. Res. Commun. 444 (4), 611-616 (2014)
Title FANCA and FANCC modulate TLR and p38 MAPK-dependent expression of IL-1beta in macrophages .
Author Garbati MR, Hays LE, Keeble W, Yates JE, Rathbun RK and Bagby GC.
Journal Blood 122 (18), 3197-3205 (2013)
Title Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease .
Author van Meurs JB, Pare G, Schwartz SM, Hazra A, Tanaka T, Vermeulen SH, Cotlarciuc I, Yuan X, Malarstig A, Bandinelli S, Bis JC, Blom H, Brown MJ, Chen C, Chen YD, Clarke RJ, Dehghan A, Erdmann J, Ferrucci L, Hamsten A, Hofman A, Hunter DJ, Goel A, Johnson AD, Kathiresan S, Kampman E, Kiel DP, Kiemeney LA, Chambers JC, Kraft P, Lindemans J, McKnight B, Nelson CP, O'Donnell CJ, Psaty BM, Ridker PM, Rivadeneira F, Rose LM, Seedorf U, Siscovick DS, Schunkert H, Selhub J, Ueland PM, Vollenweider P, Waeber G, Waterworth DM, Watkins H, Witteman JC, den Heijer M, Jacques P, Uitterlinden AG, Kooner JS, Rader DJ, Reilly MP, Mooser V, Chasman DI, Samani NJ and Ahmadi KR.
Journal Am. J. Clin. Nutr. 98 (3), 668-676 (2013)
Title Investigation of FANCA mutations in Greek patients .
Author Selenti N, Sofocleous C, Kattamis A, Kolialexi A, Kitsiou S, Fryssira E, Polychronopoulou S, Kanavakis E and Mavrou A.
Journal Anticancer Res. 33 (8), 3369-3374 (2013)
Title The genomic organization of the Fanconi anemia group A (FAA) gene .
Author Ianzano L, D'Apolito M, Centra M, Savino M, Levran O, Auerbach AD, Cleton-Jansen AM, Doggett NA, Pronk JC, Tipping AJ, Gibson RA, Mathew CG, Whitmore SA, Apostolou S, Callen DF, Zelante L and Savoia A.
Journal Genomics 41 (3), 309-314 (1997)
Title Expression cloning of a cDNA for the major Fanconi anaemia gene, .
Author Lo Ten Foe JR, Rooimans MA, Bosnoyan-Collins L, Alon N, Wijker M, Parker L, Lightfoot J, Carreau M, Callen DF, Savoia A, Cheng NC, van Berkel CG, Strunk MH, Gille JJ, Pals G, Kruyt FA, Pronk JC, Arwert F, Buchwald M and Joenje H.
Journal Nat. Genet. 14 (3), 320-323 (1996)
Title A locus for Fanconi anemia on 16q determined by homozygosity mapping .
Author Gschwend M, Levran O, Kruglyak L, Ranade K, Verlander PC, Shen S, Faure S, Weissenbach J, Altay C, Lander ES, Auerbach AD and Botstein D.
Journal Am. J. Hum. Genet. 59 (2), 377-384 (1996)
Title Localisation of the Fanconi anaemia complementation group A gene to chromosome 16q24.3 .
Author Pronk JC, Gibson RA, Savoia A, Wijker M, Morgan NV, Melchionda S, Ford D, Temtamy S, Ortega JJ and Jansen S.
Journal Nat. Genet. 11 (3), 338-340 (1995)
Title Esophageal Atresia/Tracheoesophageal Fistula Overview .
Author Scott,D.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Fanconi Anemia .
Author Alter,B.P. and Kupfer,G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.