• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fibroblast growth factor receptor 3 (FGFR3), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21453 Homo sapiens fibroblast growth factor receptor 3 (FGFR3), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu21453C Homo sapiens fibroblast growth factor receptor 3 (FGFR3), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000142.4, 254028235
Length 2421 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens fibroblast growth factor receptor 3 (FGFR3), transcript variant 1, mRNA.
Product fibroblast growth factor receptor 3 isoform 1 precursor
Comment

Summary: This gene encodes a member of the fibroblast growth factor receptor (FGFR) family, with its amino acid sequence being highly conserved between members and among divergent species. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member binds acidic and basic fibroblast growth hormone and plays a role in bone development and maintenance. Mutations in this gene lead to craniosynostosis and multiple types of skeletal dysplasia. Three alternatively spliced transcript variants that encode different protein isoforms have been described. [provided by RefSeq, Jul 2009].


Transcript Variant: This variant (1) is the predominant transcript. The resulting protein (isoform 1) has the IIIc-type C-terminal half of the IgIII domain.


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000133.1
CDS 257..2677
Misc Feature(1)413..586
Misc Feature(2)416..>583
Misc Feature(3)737..991
Misc Feature(4)order(743..745,749..751,755..757)
Misc Feature(5)order(746..748,767..775,779..781)
Misc Feature(6)764..961
Misc Feature(7)1034..1324
Misc Feature(8)1058..1327
Misc Feature(9)order(1085..1087,1100..1108,1193..1198,1208..1210,
Misc Feature(10)1382..1444
Misc Feature(11)1631..2632
Misc Feature(12)1670..2500
Misc Feature(13)order(1688..1702,1712..1714,1772..1774,1778..1780,
Misc Feature(14)order(1688..1702,1712..1714,1772..1774,1778..1780,
Misc Feature(15)order(1700..1702,1940..1942,1946..1948,2105..2107,
Misc Feature(16)1985..1987
Misc Feature(17)order(2156..2176,2222..2233)
Misc Feature(18)2195..2197
Misc Feature(19)2195..2197
Misc Feature(20)2198..2200
Misc Feature(21)2198..2200
Misc Feature(22)2426..2428
Misc Feature(23)2426..2428
Misc Feature(24)2534..2536
Misc Feature(25)2534..2536
Misc Feature(26)2564..2566
Exon (1)1..154
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (2)155..365
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (3)366..635
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (4)636..701
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (5)702..871
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (6)872..995
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (7)996..1186
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (8)1187..1331
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (9)1332..1522
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (10)1523..1668
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (11)1669..1790
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (12)1791..1901
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (13)1902..2092
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (14)2093..2215
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (15)2216..2286
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (16)2287..2424
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (17)2425..2530
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Exon (18)2531..4287
Gene:FGFR3
Gene Synonym:ACH; CD333; CEK2; HSFGFR3EX; JTK4
Translation MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS SSSGDDSVFAHDLLPPAPPSSGGSRT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
38+dbSNP:
38+c, gdbSNP:17880408
222..223+dbSNP:
222..223+, cdbSNP:35593071
373+dbSNP:
373+a, gdbSNP:376223299
386+a, gdbSNP:146080119
410+a, gdbSNP:140087676
414+c, gdbSNP:201433984
415+c, tdbSNP:143548893
416+a, gdbSNP:370940011
425+a, gdbSNP:61735064
428+a, gdbSNP:374561001
433+c, gdbSNP:373292806
436+c, tdbSNP:368789915
444+c, gdbSNP:371729802
445+a, gdbSNP:140377760
449+a, gdbSNP:2305178
456+a, gdbSNP:369232922
461+a, gdbSNP:373818958
507+c, tdbSNP:121913116
508+a, gdbSNP:367973461
528+c, tdbSNP:144995231
533+c, tdbSNP:199968400
558+g, tdbSNP:80029045
559+c, tdbSNP:371715444
568+c, tdbSNP:377018654
572+a, gdbSNP:369634049
577+c, tdbSNP:368613176
604+c, tdbSNP:2305179
621+a, gdbSNP:377198109
626+c, tdbSNP:199740841
638+dbSNP:
638+a, gdbSNP:200300532
645+c, tdbSNP:113172184
649+a, gdbSNP:55662109
658+c, tdbSNP:199792768
672+a, cdbSNP:376268669
673+c, tdbSNP:3135867
757+a, gdbSNP:111455601
769+c, tdbSNP:373209526
829+c, tdbSNP:377492283
844+c, tdbSNP:2305180
859+c, tdbSNP:2305181
889+dbSNP:
889+a, gdbSNP:369033272
895+a, gdbSNP:138707520
910+c, gdbSNP:147769045
916+a, cdbSNP:146927248
919+a, gdbSNP:114421370
922+c, tdbSNP:201081464
934+c, tdbSNP:141575580
941+c, gdbSNP:368831528
946+a, gdbSNP:371766123
963+a, gdbSNP:200495316
969+a, gdbSNP:199944818
976+a, gdbSNP:369366713
981+c, tdbSNP:150916178
998+dbSNP:
998+c, tdbSNP:121913482
1002+c, gdbSNP:121913483
1004+a, cdbSNP:373470718
1005+c, gdbSNP:4647924
1009+c, gdbSNP:377554120
1027+a, gdbSNP:138334098
1049+a, gdbSNP:151254213
1063+c, tdbSNP:199614237
1066+c, tdbSNP:142910057
1089+a, gdbSNP:121913115
1091+a, tdbSNP:121913114
1120+c, tdbSNP:146127079
1126+c, tdbSNP:370518637
1138+c, tdbSNP:2234909
1141+c, tdbSNP:375181682
1156+a, gdbSNP:143723106
1159+c, tdbSNP:377588489
1161+a, gdbSNP:371176140
1168+c, gdbSNP:201012537
1171+c, tdbSNP:144675978
1177+c, tdbSNP:148518372
1189+dbSNP:
1189+a, gdbSNP:142805104
1192+a, gdbSNP:199856426
1195+c, tdbSNP:201679424
1200+a, cdbSNP:371410933
1207+c, tdbSNP:368192848
1219+a, gdbSNP:201221388
1220+a, gdbSNP:121913111
1236+a, gdbSNP:372315097
1241+a, gdbSNP:188723332
1246+c, tdbSNP:2305185
1255+c, tdbSNP:370530264
1256+a, gdbSNP:373496046
1258+c, tdbSNP:376787929
1270+c, tdbSNP:4647928
1279+a, gdbSNP:147833498
1286..1287+, adbSNP:34723753
1287+c, tdbSNP:199702395
1324+a, gdbSNP:201947443
1325+c, tdbSNP:141207920
1358+a, gdbSNP:201136923
1362+c, tdbSNP:146970233
1364+g, tdbSNP:121913479
1367+a, tdbSNP:121913484
1374+a, gdbSNP:121913485
1379+a, cdbSNP:386626606
1386+g, tdbSNP:267606809
1393+c, tdbSNP:137896792
1394+a, c, gdbSNP:28931614
1397+a, gdbSNP:149023204
1404+g, tdbSNP:11943863
1406+c, tdbSNP:17881656
1409+c, tdbSNP:200186825
1428+a, cdbSNP:28931615
1429+a, gdbSNP:148157107
1451+c, tdbSNP:370064407
1454+a, gdbSNP:373034495
1460+a, cdbSNP:374947075
1463+a, gdbSNP:373640210
1465+a, gdbSNP:151306939
1470+a, gdbSNP:201813356
1472+c, gdbSNP:201751659
1474+c, gdbSNP:187314275
1493+a, cdbSNP:375687485
1495+a, gdbSNP:140898926
1498+c, tdbSNP:143094785
1502+c, tdbSNP:146114742
1516+g, tdbSNP:369368608
1539+dbSNP:
1539+a, gdbSNP:138986264
1541+a, gdbSNP:182935140
1543+a, gdbSNP:187229103
complement(1546)-t, cdbSNP:3135891
1561+a, gdbSNP:3135892
1563+c, tdbSNP:142030909
1576+c, tdbSNP:190111780
1577+a, gdbSNP:17884368
1595+, gdbSNP:35317612
1601+c, tdbSNP:61735104
1605+c, tdbSNP:56240927
1610+c, tdbSNP:3135893
1612+a, cdbSNP:149555011
1619+g, tdbSNP:144242294
1621+c, tdbSNP:376488233
1627+c, tdbSNP:199758988
1696+dbSNP:
1696+g, tdbSNP:200780581
1710+a, gdbSNP:267606808
1711+a, gdbSNP:377021699
1732+c, tdbSNP:373254179
1751+c, gdbSNP:370646097
1753+c, tdbSNP:140594137
1769+a, gdbSNP:144546453
1774+c, tdbSNP:147823561
1793+dbSNP:
1793+a, gdbSNP:121913112
1806+a, gdbSNP:139707740
1807+a, gdbSNP:142622642
1828+c, tdbSNP:150945966
1876+a, c, gdbSNP:28933068
1885+c, gdbSNP:61735103
1903+dbSNP:
1903+g, tdbSNP:3135897
1912+c, tdbSNP:150083071
1913+a, gdbSNP:199544087
1927+c, tdbSNP:370408732
1945+a, gdbSNP:199779110
1957+c, gdbSNP:372367824
1962+c, tdbSNP:146672976
1971+c, tdbSNP:377141691
1981+a, gdbSNP:141422828
1993+c, tdbSNP:200589145
2007+c, tdbSNP:145183329
2008+a, gdbSNP:139020690
2026+c, gdbSNP:373391057
2077+c, tdbSNP:370203006
2082+c, tdbSNP:142093553
2101+dbSNP:
2101+c, tdbSNP:375856533
2118+a, gdbSNP:121913113
2134+c, tdbSNP:369137031
2135+a, gdbSNP:200849753
2143+c, tdbSNP:104886004
2164+c, gdbSNP:104886005
2179+c, tdbSNP:148104605
2191+c, tdbSNP:104886006
2204+a, c, gdbSNP:78311289
2205+a, tdbSNP:121913105
2206+c, g, tdbSNP:28928868
2209+a, gdbSNP:7688609
2215+c, tdbSNP:150609697
2224+dbSNP:
2224+a, gdbSNP:368518454
2242+a, gdbSNP:371563013
2281+c, tdbSNP:200980490
2299+dbSNP:
2299+a, gdbSNP:17883356
2305+c, gdbSNP:371884239
2323+a, gdbSNP:200872971
2344+c, tdbSNP:142884145
2345+g, tdbSNP:121913480
2368+a, cdbSNP:376497115
2370+a, gdbSNP:369813768
2385+g, tdbSNP:104886023
2391+a, gdbSNP:104886024
2404+c, tdbSNP:373967853
2405+a, gdbSNP:17882190
2409+a, gdbSNP:139773438
2419+c, gdbSNP:371088132
2431+dbSNP:
2431+a, gdbSNP:377402598
2432+a, tdbSNP:17880763
2439+a, gdbSNP:149924317
2456+a, gdbSNP:188849608
2461+c, gdbSNP:145020302
2463+a, cdbSNP:148631462
2470+a, gdbSNP:200624062
2473+c, gdbSNP:377293519
2497+c, tdbSNP:142137666
2500+a, gdbSNP:368790668
2506+c, tdbSNP:375310360
2515+c, tdbSNP:146662137
2516+a, gdbSNP:373425119
2528+a, gdbSNP:56266857
2550+c, tdbSNP:140211846
2566+c, gdbSNP:367757357
2572+a, gdbSNP:200629304
2587+c, tdbSNP:189264142
2595+c, gdbSNP:140616343
2618+a, gdbSNP:371433215
2626+c, gdbSNP:138078624
2630+a, gdbSNP:376043260
2637+ga, tdbSNP:121913481
2641+c, tdbSNP:369424084
2652+c, tdbSNP:150452037
2653+a, cdbSNP:372401311
2668+a, gdbSNP:375563964
2669+c, tdbSNP:369758941
2673+c, tdbSNP:374547489
2675+a, c, g, tdbSNP:121913101
2676+g, tdbSNP:397515514
2677+a, c, g, tdbSNP:121913103
2682+c, gdbSNP:17879364
2691+c, tdbSNP:149119664
2700+a, gdbSNP:143130353
2709+c, gdbSNP:148257939
2713+a, gdbSNP:3135900
2730+c, tdbSNP:147471896
2737+a, gdbSNP:375248814
2741+a, cdbSNP:138412839
2753+a, gdbSNP:143797885
2781+a, cdbSNP:150623219
2793+c, tdbSNP:139961981
2794..2795+, tdbSNP:35582695
2809+c, tdbSNP:149863736
2811+c, tdbSNP:78260022
2815+c, tdbSNP:73202816
2816..2817+, gtdbSNP:34562534
2817..2818+, tgdbSNP:34003391
2833..2834+, tgdbSNP:397821865
2842+a, gdbSNP:112613951
2861+c, tdbSNP:3135901
2875+a, gdbSNP:139656072
2879+a, gdbSNP:3135902
2888+c, gdbSNP:146843671
2890+c, gdbSNP:17884965
2916+c, gdbSNP:146686766
2946+, gdbSNP:36110512
2947+c, tdbSNP:140307141
2961+a, gdbSNP:142499367
2964+c, tdbSNP:17882030
2997+a, gdbSNP:150943855
2998+c, gdbSNP:140878423
3000+c, tdbSNP:376272599
3018+a, cdbSNP:150156689
3022+c, gdbSNP:138933598
3036+c, tdbSNP:370938444
3037+a, gdbSNP:17881782
3039+c, tdbSNP:141307773
3045+c, tdbSNP:146988530
3058+a, gdbSNP:138377208
3061+c, tdbSNP:149595424
3075+c, tdbSNP:144231750
3078+c, tdbSNP:373601917
3080..3081+, gdbSNP:34288608
3083+c, tdbSNP:148309209
3093+c, tdbSNP:141419414
3094+c, gdbSNP:200015882
3098+g, tdbSNP:150892094
3104+c, tdbSNP:139770971
3112+a, gdbSNP:142940849
3115+a, gdbSNP:146131833
3129+a, gdbSNP:367689136
3140+, cdbSNP:34583865
3144+g, tdbSNP:139197142
complement(3175)-g, adbSNP:17880626
3197+c, tdbSNP:144268232
3199+c, gdbSNP:3135903
3215+a, tdbSNP:149915836
3244+c, tdbSNP:17878568
3299+a, gdbSNP:184903110
3337..3338+, atdbSNP:17878315
3337..3338+, atdbSNP:386544957
3353+c, tdbSNP:144953313
3377..3378+, c, tdbSNP:34750071
3377+, cdbSNP:35222799
3408+c, gdbSNP:148600108
3419+a, gdbSNP:113572688
3475+c, tdbSNP:3135904
3540+c, tdbSNP:189748716
3561+c, tdbSNP:376155579
3582+g, tdbSNP:376062760
3591+a, gdbSNP:180944260
3595+c, tdbSNP:185946582
3608..3609+, tdbSNP:139431979
3639+c, tdbSNP:199807707
3718+c, tdbSNP:191993060
3791+a, gdbSNP:17883581
3966..3969+, tatadbSNP:17882393
3980+c, tdbSNP:370751685
4038+c, tdbSNP:2121456
4085+g, tdbSNP:76953537
4086+g, tdbSNP:78424000
4087+c, gdbSNP:74995745
4097+a, gdbSNP:181727722
complement(4156)-t, cdbSNP:4647929
Gene SymbolFGFR3
Gene SynonymACH; CD333; CEK2; HSFGFR3EX; JTK4
Chromosome4
Locus Map4p16.3
Title Genome-wide association study identifies multiple loci associated with bladder cancer risk .
Author Figueroa JD, Ye Y, Siddiq A, Garcia-Closas M, Chatterjee N, Prokunina-Olsson L, Cortessis VK, Kooperberg C, Cussenot O, Benhamou S, Prescott J, Porru S, Dinney CP, Malats N, Baris D, Purdue M, Jacobs EJ, Albanes D, Wang Z, Deng X, Chung CC, Tang W, Bas Bueno-de-Mesquita H, Trichopoulos D, Ljungberg B, Clavel-Chapelon F, Weiderpass E, Krogh V, Dorronsoro M, Travis R, Tjonneland A, Brenan P, Chang-Claude J, Riboli E, Conti D, Gago-Dominguez M, Stern MC, Pike MC, Van Den Berg D, Yuan JM, Hohensee C, Rodabough R, Cancel-Tassin G, Roupret M, Comperat E, Chen C, De Vivo I, Giovannucci E, Hunter DJ, Kraft P, Lindstrom S, Carta A, Pavanello S, Arici C, Mastrangelo G, Kamat AM, Lerner SP, Barton Grossman H, Lin J, Gu J, Pu X, Hutchinson A, Burdette L, Wheeler W, Kogevinas M, Tardon A, Serra C, Carrato A, Garcia-Closas R, Lloreta J, Schwenn M, Karagas MR, Johnson A, Schned A, Armenti KR, Hosain GM, Andriole G Jr, Grubb R 3rd, Black A, Ryan Diver W, Gapstur SM, Weinstein SJ, Virtamo J, Haiman CA, Landi MT, Caporaso N, Fraumeni JF Jr, Vineis P, Wu X, Silverman DT, Chanock S and Rothman N.
Journal Hum. Mol. Genet. 23 (5), 1387-1398 (2014)
Title Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism .
Author Corominas R, Yang X, Lin GN, Kang S, Shen Y, Ghamsari L, Broly M, Rodriguez M, Tam S, Trigg SA, Fan C, Yi S, Tasan M, Lemmens I, Kuang X, Zhao N, Malhotra D, Michaelson JJ, Vacic V, Calderwood MA, Roth FP, Tavernier J, Horvath S, Salehi-Ashtiani K, Korkin D, Sebat J, Hill DE, Hao T, Vidal M and Iakoucheva LM.
Journal Nat Commun 5, 3650 (2014)
Title Mutations of fibroblast growth factor receptor 3 gene (FGFR3) in transitional cell carcinoma of urinary bladder in Thai patients [Revision-2a] .
Author Jantip J, Tanthanuch M, Kanngurn S, Karnchanawanichkul W, Pripatnanont C, Sangkhathat S and Thongsuksai P.
Journal J Med Assoc Thai 96 (8), 976-983 (2013)
Title Hypochondroplasia .
Author Bober,M.B., Bellus,G.A., Nikkel,S.M. and Tiller,G.E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title FGFR-Related Craniosynostosis Syndromes .
Author Robin,N.H., Falk,M.J. and Haldeman-Englert,C.R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Muenke Syndrome .
Author Agochukwu,N.B., Doherty,E.S. and Muenke,M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Thanatophoric Dysplasia .
Author Karczeski,B. and Cutting,G.R.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Achondroplasia .
Author Pauli,R.M.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title A gene encoding a fibroblast growth factor receptor isolated from the Huntington disease gene region of human chromosome 4 .
Author Thompson LM, Plummer S, Schalling M, Altherr MR, Gusella JF, Housman DE and Wasmuth JJ.
Journal Genomics 11 (4), 1133-1142 (1991)
Title Isolation of an additional member of the fibroblast growth factor receptor family, FGFR-3 .
Author Keegan K, Johnson DE, Williams LT and Hayman MJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (4), 1095-1099 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.