• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens fucosyltransferase 6 (alpha (1,3) fucosyltransferase) (FUT6), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000150 Homo sapiens fucosyltransferase 6 (alpha (1,3) fucosyltransferase) (FUT6), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $549.00 14

*Business Day

Related Services

RefSeq Version NM_000150.2, 103472034
Length 3137 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens fucosyltransferase 6 (alpha (1,3) fucosyltransferase) (FUT6), transcript variant 1, mRNA.
Product alpha-(1,3)-fucosyltransferase
Comment

Summary: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript. Variants 1 and 2 both encode the same protein.

RefSeq NP_000141.1
CDS 1196..2275
Misc Feature(1)1190..1192
Misc Feature(2)1232..2269
Misc Feature(3)1232..2269
Misc Feature(4)1238..1297
Exon (1)1..1055
Gene:FUT6
Gene Synonym:FCT3A; FT1A; Fuc-TVI; FucT-VI
Exon (2)1056..1183
Gene:FUT6
Gene Synonym:FCT3A; FT1A; Fuc-TVI; FucT-VI
Exon (3)1184..3137
Gene:FUT6
Gene Synonym:FCT3A; FT1A; Fuc-TVI; FucT-VI
Translation MDPLGPAKPQWSWRCCLTTLLFQLLMAVCFFSYLRVSQDDPTVYPNGSRFPDSTGTPAHS IPLILLWTWPFNKPIALPRCSEMVPGTADCNITADRKVYPQADAVIVHHREVMYNPSAQL PRSPRRQGQRWIWFSMESPSHCWQLKAMDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAH PPLNLSAKTELVAWAVSNWGPNSARVRYYQSLQAHLKVDVYGRSHKPLPQGTMMETLSRY KFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKD LARYLQELDKDHARYLSYFRWRETLRPRSFSWALAFCKACWKLQEESRYQTRGIAAWFT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(7)-dbSNP:
complement(7)-t, cdbSNP:141189382
complement(130)-c, adbSNP:778798
complement(182)-g, adbSNP:192361745
complement(237)-g, cdbSNP:185205230
complement(276)-g, adbSNP:148224427
complement(317)-g, cdbSNP:143110842
complement(518)-t, cdbSNP:116953194
complement(700)-t, cdbSNP:149084677
complement(820)-g, adbSNP:182398606
complement(907)-c, adbSNP:116792659
complement(963)-g, adbSNP:190182678
complement(1014)-t, cdbSNP:73920069
complement(1115..1116)-dbSNP:
complement(1115..1116)-, cdbSNP:35285366
complement(1185)-dbSNP:
complement(1185)-c, adbSNP:9807877
complement(1202)-g, adbSNP:200710904
complement(1213)-t, cdbSNP:143668927
complement(1255)-c, adbSNP:147518378
complement(1258)-t, cdbSNP:113764706
complement(1264)-g, cdbSNP:17855737
complement(1298)-g, adbSNP:201524447
complement(1299)-t, cdbSNP:144807324
complement(1310)-t, cdbSNP:202215473
complement(1313)-t, cdbSNP:141062404
complement(1333)-g, adbSNP:199791598
complement(1367)-t, cdbSNP:112849079
complement(1372)-g, cdbSNP:201687215
complement(1399)-t, cdbSNP:150692510
complement(1428)-g, adbSNP:200341405
complement(1467)-t, gdbSNP:141842356
complement(1473)-g, adbSNP:148077576
complement(1476)-g, adbSNP:144743691
complement(1478)-t, cdbSNP:199597075
complement(1505)-t, cdbSNP:142068894
complement(1506)-g, cdbSNP:200968732
complement(1507)-t, cdbSNP:138857915
complement(1523)-g, cdbSNP:192615441
complement(1524)-t, cdbSNP:72486354
complement(1531)-t, gdbSNP:114460969
complement(1555)-g, adbSNP:115405004
complement(1559)-g, adbSNP:138645125
complement(1564)-g, adbSNP:189959983
complement(1565)-t, cdbSNP:778805
complement(1567)-t, cdbSNP:185108416
complement(1571)-g, adbSNP:111589452
complement(1572)-t, cdbSNP:201634023
complement(1584)-t, cdbSNP:200897572
complement(1638)-g, adbSNP:202219878
complement(1671)-t, cdbSNP:140726017
complement(1696..1697)-, gdbSNP:150560931
complement(1720)-g, adbSNP:150924444
complement(1722)-c, adbSNP:111494384
complement(1733)-g, adbSNP:145009020
complement(1746)-t, cdbSNP:146819588
complement(1775)-g, adbSNP:147795465
complement(1780)-t, cdbSNP:401508
complement(1794)-g, adbSNP:2879401
complement(1798)-g, adbSNP:4041473
complement(1799)-g, adbSNP:3964631
complement(1804)-t, g, c, adbSNP:445878
complement(1815)-t, cdbSNP:144398741
complement(1837)-t, cdbSNP:364587
complement(1853)-t, cdbSNP:192315992
complement(1855)-c, adbSNP:139398925
complement(1859)-t, cdbSNP:146312446
complement(1862)-g, adbSNP:141945646
complement(1883)-c, adbSNP:364637
complement(1888)-g, adbSNP:443907
complement(1902)-g, adbSNP:146077344
complement(1903)-t, cdbSNP:141754965
complement(1924)-g, adbSNP:79359759
complement(1933)-g, adbSNP:141349215
complement(1934)-g, adbSNP:17855739
complement(1951)-g, adbSNP:200051257
complement(1964)-t, cdbSNP:199718441
complement(2005)-g, adbSNP:150055699
complement(2049)-g, adbSNP:146941796
complement(2050)-t, cdbSNP:112313064
complement(2053)-g, adbSNP:200779357
complement(2056)-g, adbSNP:147799077
complement(2074)-g, adbSNP:62110261
complement(2077)-g, adbSNP:141055382
complement(2102)-g, cdbSNP:61147939
complement(2103)-t, cdbSNP:142915411
complement(2131)-g, adbSNP:148596155
complement(2140)-t, gdbSNP:145035679
complement(2166)-g, adbSNP:61739551
complement(2167)-t, cdbSNP:140002776
complement(2172)-t, cdbSNP:61739552
complement(2197)-g, cdbSNP:61740561
complement(2218)-t, cdbSNP:192545727
complement(2249)-g, adbSNP:201278961
complement(2252)-t, cdbSNP:139295920
complement(2259)-t, gdbSNP:150572233
complement(2281)-g, adbSNP:201366529
complement(2352)-t, gdbSNP:200530785
complement(2523)-t, adbSNP:147377203
complement(2578)-t, cdbSNP:116794036
complement(2667)-g, cdbSNP:186655016
complement(2673)-t, cdbSNP:182930080
complement(2697)-, gdbSNP:34079155
complement(2774)-t, cdbSNP:191083363
complement(2784)-g, cdbSNP:12971282
complement(2787)-t, cdbSNP:142774588
complement(2845)-g, adbSNP:778806
complement(2852)-t, cdbSNP:12986368
complement(2864)-t, cdbSNP:138814800
complement(2968)-t, cdbSNP:188390343
complement(2975)-g, adbSNP:35845041
complement(2981)-, tdbSNP:35628490
complement(2995)-t, cdbSNP:778807
complement(3054)-t, cdbSNP:190325668
complement(3070)-g, adbSNP:185911395
complement(3117)-t, cdbSNP:181778413
Gene SymbolFUT6
Gene SynonymFCT3A; FT1A; Fuc-TVI; FucT-VI
Chromosome19
Locus Map19p13.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000150 Homo sapiens fucosyltransferase 6 (alpha (1,3) fucosyltransferase) (FUT6), transcript variant 1, mRNA. On-demand $549.00 14
NM_001040701 Homo sapiens fucosyltransferase 6 (alpha (1,3) fucosyltransferase) (FUT6), transcript variant 2, mRNA. On-demand $549.00 14
Title Genome-wide association study identifies novel loci associated with serum level of vitamin B12 in Chinese men .
Author Lin,X., Lu,D., Gao,Y., Tao,S., Yang,X., Feng,J., Tan,A., Zhang,H., Hu,Y., Qin,X., Kim,S.T., Peng,T., Li,L., Mo,L., Zhang,S., Trent,J.M., Mo,Z., Zheng,S.L., Xu,J. and Sun,J.
Journal Hum. Mol. Genet. 21 (11), 2610-2617 (2012)
Title Functional analysis of alpha1,3/4-fucosyltransferase VI in human hepatocellular carcinoma cells .
Author Guo,Q., Guo,B., Wang,Y., Wu,J., Jiang,W., Zhao,S., Qiao,S. and Wu,Y.
Journal Biochem. Biophys. Res. Commun. 417 (1), 311-317 (2012)
Title The biosynthesis of the selectin-ligand sialyl Lewis x in colorectal cancer tissues is regulated by fucosyltransferase VI and can be inhibited by an RNA interference-based approach .
Author Trinchera,M., Malagolini,N., Chiricolo,M., Santini,D., Minni,F., Caretti,A. and Dall'olio,F.
Journal Int. J. Biochem. Cell Biol. 43 (1), 130-139 (2011)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title Genomics meets glycomics-the first GWAS study of human N-Glycome identifies HNF1alpha as a master regulator of plasma protein fucosylation .
Author Lauc,G., Essafi,A., Huffman,J.E., Hayward,C., Knezevic,A., Kattla,J.J., Polasek,O., Gornik,O., Vitart,V., Abrahams,J.L., Pucic,M., Novokmet,M., Redzic,I., Campbell,S., Wild,S.H., Borovecki,F., Wang,W., Kolcic,I., Zgaga,L., Gyllensten,U., Wilson,J.F., Wright,A.F., Hastie,N.D., Campbell,H., Rudd,P.M. and Rudan,I.
Journal PLoS Genet. 6 (12), E1001256 (2010)
Title Expression of human chromosome 19p alpha(1,3)-fucosyltransferase genes in normal tissues. Alternative splicing, polyadenylation, and isoforms .
Author Cameron,H.S., Szczepaniak,D. and Weston,B.W.
Journal J. Biol. Chem. 270 (34), 20112-20122 (1995)
Title Physical maps of human alpha (1,3)fucosyltransferase genes FUT3-FUT6 on chromosomes 19p13.3 and 11q21 .
Author McCurley,R.S., Recinos,A. III, Olsen,A.S., Gingrich,J.C., Szczepaniak,D., Cameron,H.S., Krauss,R. and Weston,B.W.
Journal Genomics 26 (1), 142-146 (1995)
Title Relative positions of two clusters of human alpha-L-fucosyltransferases in 19q (FUT1-FUT2) and 19p (FUT6-FUT3-FUT5) within the microsatellite genetic map of chromosome 19 .
Author Reguigne-Arnould,I., Couillin,P., Mollicone,R., Faure,S., Fletcher,A., Kelly,R.J., Lowe,J.B. and Oriol,R.
Journal Cytogenet. Cell Genet. 71 (2), 158-162 (1995)
Title Molecular cloning of a fourth member of a human alpha (1,3)fucosyltransferase gene family. Multiple homologous sequences that determine expression of the Lewis x, sialyl Lewis x, and difucosyl sialyl Lewis x epitopes .
Author Weston,B.W., Smith,P.L., Kelly,R.J. and Lowe,J.B.
Journal J. Biol. Chem. 267 (34), 24575-24584 (1992)
Title The cloning and expression of a human alpha-1,3 fucosyltransferase capable of forming the E-selectin ligand .
Author Koszdin,K.L. and Bowen,B.R.
Journal Biochem. Biophys. Res. Commun. 187 (1), 152-157 (1992)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.