• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glycoprotein IX (platelet) (GP9), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18917 Homo sapiens glycoprotein IX (platelet) (GP9), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu18917C Homo sapiens glycoprotein IX (platelet) (GP9), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000174.3, 208609983
Length 534 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens glycoprotein IX (platelet) (GP9), mRNA.
Product platelet glycoprotein IX precursor
Comment

Summary: This gene encodes a small membrane glycoprotein found on the surface of human platelets. It forms a 1-to-1 noncovalent complex with glycoprotein Ib, a platelet surface membrane glycoprotein complex that functions as a receptor for von Willebrand factor. The complete receptor complex includes noncovalent association of the alpha and beta subunits with the protein encoded by this gene and platelet glycoprotein V. Defects in this gene are a cause of Bernard-Soulier syndrome, also known as giant platelet disease. These patients have unusually large platelets and have a clinical bleeding tendency. [provided by RefSeq, Oct 2008].

RefSeq NP_000165.1
CDS 188..721
Misc Feature(1)158..160
Misc Feature(2)236..238
Misc Feature(3)242..352
Misc Feature(4)347..>445
Misc Feature(5)365..436
Misc Feature(6)440..577
Misc Feature(7)497..499
Misc Feature(8)629..691
Exon (1)1..49
Gene:GP9
Gene Synonym:CD42a; GPIX
Exon (2)50..175
Gene:GP9
Gene Synonym:CD42a; GPIX
Exon (3)176..858
Gene:GP9
Gene Synonym:CD42a; GPIX
Translation MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Gene SymbolGP9
Gene SynonymCD42a; GPIX
Chromosome3
Locus Map3q21.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000174 Homo sapiens glycoprotein IX (platelet) (GP9), mRNA. On-demand TBD TBD
NM_000174 Homo sapiens glycoprotein IX (platelet) (GP9), mRNA. On-demand TBD TBD
Title Novel genetic abnormalities in Bernard-Soulier syndrome in India .
Author Ali S, Ghosh K and Shetty S.
Journal Ann. Hematol. 93 (3), 381-384 (2014)
Title Bernard-Soulier syndrome: an update .
Author Andrews RK and Berndt MC.
Journal Semin. Thromb. Hemost. 39 (6), 656-662 (2013)
Title Platelets with a W127X mutation in GPIX express sufficient residual amounts of GPIbalpha to support adhesion to von Willebrand factor and collagen .
Author Takata Y, Kanaji T, Moroi M, Seki R, Sano M, Nakazato S, Sueoka E, Imamura Y and Okamura T.
Journal Int. J. Hematol. 96 (6), 733-742 (2012)
Title Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIbbeta and a GPIbbeta/GPIX chimera .
Author McEwan PA, Yang W, Carr KH, Mo X, Zheng X, Li R and Emsley J.
Journal Blood 118 (19), 5292-5301 (2011)
Title Molecular basis of Bernard-Soulier syndrome in 27 patients from India .
Author Sumitha E, Jayandharan GR, David S, Jacob RR, Sankari Devi G, Bargavi B, Shenbagapriya S, Nair SC, Abraham A, George B, Viswabandya A, Mathews V, Chandy M and Srivastava A.
Journal J. Thromb. Haemost. 9 (8), 1590-1598 (2011)
Title von Willebrand factor binding to platelet GpIb initiates signals for platelet activation .
Author Kroll MH, Harris TS, Moake JL, Handin RI and Schafer AI.
Journal J. Clin. Invest. 88 (5), 1568-1573 (1991)
Title Human platelet glycoprotein IX. Characterization of cDNA and localization of the gene to chromosome 3 .
Author Hickey MJ, Deaven LL and Roth GJ.
Journal FEBS Lett. 274 (1-2), 189-192 (1990)
Title Purification of botrocetin from Bothrops jararaca venom. Analysis of the botrocetin-mediated interaction between von Willebrand factor and the human platelet membrane glycoprotein Ib-IX complex .
Author Andrews RK, Booth WJ, Gorman JJ, Castaldi PA and Berndt MC.
Journal Biochemistry 28 (21), 8317-8326 (1989)
Title Human platelet glycoprotein IX: an adhesive prototype of leucine-rich glycoproteins with flank-center-flank structures .
Author Hickey MJ, Williams SA and Roth GJ.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (17), 6773-6777 (1989)
Title Glycoprotein Ib and glycoprotein IX are fully complexed in the intact platelet membrane .
Author Du,X., Beutler,L., Ruan,C., Castaldi,P.A. and Berndt,M.C.
Journal Blood 69 (5), 1524-1527 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.