• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glycoprotein IX (platelet) (GP9), mRNA.


RefSeq Accession Definition Services Price Order
NM_000174 Homo sapiens glycoprotein IX (platelet) (GP9), mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000174.3, 208609983
Length 858 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens glycoprotein IX (platelet) (GP9), mRNA.
Product platelet glycoprotein IX precursor
Comment

Summary: This gene encodes a small membrane glycoprotein found on the surface of human platelets. It forms a 1-to-1 noncovalent complex with glycoprotein Ib, a platelet surface membrane glycoprotein complex that functions as a receptor for von Willebrand factor. The complete receptor complex includes noncovalent association of the alpha and beta subunits with the protein encoded by this gene and platelet glycoprotein V. Defects in this gene are a cause of Bernard-Soulier syndrome, also known as giant platelet disease. These patients have unusually large platelets and have a clinical bleeding tendency. [provided by RefSeq, Oct 2008].

RefSeq NP_000165.1
CDS 188..721
Misc Feature(1)158..160
Misc Feature(2)236..238
Misc Feature(3)242..352
Misc Feature(4)365..436
Misc Feature(5)440..577
Misc Feature(6)497..499
Misc Feature(7)629..691
Exon (1)1..49
Gene:GP9
Gene Synonym:CD42a; GPIX
Exon (2)50..175
Gene:GP9
Gene Synonym:CD42a; GPIX
Exon (3)176..858
Gene:GP9
Gene Synonym:CD42a; GPIX
Translation MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
64+dbSNP:
64+c, tdbSNP:144100272
71+c, tdbSNP:35542024
101+c, tdbSNP:146474708
174+a, cdbSNP:184163357
205+c, tdbSNP:200376043
207+c, tdbSNP:121918038
257+c, tdbSNP:28933378
267+a, gdbSNP:147675904
289+a, gdbSNP:140929300
297+a, gdbSNP:121918036
310+c, tdbSNP:201755437
319+a, gdbSNP:6069
342+a, gdbSNP:138811539
354+c, tdbSNP:28933377
369+a, gdbSNP:5030764
390+c, tdbSNP:145472050
399+c, tdbSNP:121918037
423+c, tdbSNP:200640594
428+a, gdbSNP:137994346
436+a, gdbSNP:142692011
477+a, gdbSNP:146025958
490+a, gdbSNP:148622572
505+a, gdbSNP:141151793
516+a, gdbSNP:201341449
521+c, tdbSNP:200489927
555+c, tdbSNP:202229101
561+a, gdbSNP:61734182
562+c, tdbSNP:61732506
632+c, tdbSNP:144345517
641+a, gdbSNP:116821050
653+a, gdbSNP:3796130
675+a, cdbSNP:181175542
728+c, tdbSNP:115005114
732+a, cdbSNP:13094659
Gene SymbolGP9
Gene SynonymCD42a; GPIX
Chromosome3
Locus Map3q21.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000174 Homo sapiens glycoprotein IX (platelet) (GP9), mRNA. Full Length $248.82
ORF Sequence $159.00
Title Platelets with a W127X mutation in GPIX express sufficient residual amounts of GPIbalpha to support adhesion to von Willebrand factor and collagen .
Author Takata,Y., Kanaji,T., Moroi,M., Seki,R., Sano,M., Nakazato,S., Sueoka,E., Imamura,Y. and Okamura,T.
Journal Int. J. Hematol. 96 (6), 733-742 (2012)
Title Quaternary organization of GPIb-IX complex and insights into Bernard-Soulier syndrome revealed by the structures of GPIbbeta and a GPIbbeta/GPIX chimera .
Author McEwan,P.A., Yang,W., Carr,K.H., Mo,X., Zheng,X., Li,R. and Emsley,J.
Journal Blood 118 (19), 5292-5301 (2011)
Title Molecular basis of Bernard-Soulier syndrome in 27 patients from India .
Author Sumitha,E., Jayandharan,G.R., David,S., Jacob,R.R., Sankari Devi,G., Bargavi,B., Shenbagapriya,S., Nair,S.C., Abraham,A., George,B., Viswabandya,A., Mathews,V., Chandy,M. and Srivastava,A.
Journal J. Thromb. Haemost. 9 (8), 1590-1598 (2011)
Title Delineating the roles of the GPIIb/IIIa and GP-Ib-IX-V platelet receptors in mediating platelet adhesion to adsorbed fibrinogen and albumin .
Author Sivaraman,B. and Latour,R.A.
Journal Biomaterials 32 (23), 5365-5370 (2011)
Title Platelet glycoprotein Ib beta/IX mediates glycoprotein Ib alpha localization to membrane lipid domain critical for von Willebrand factor interaction at high shear .
Author Geng,H., Xu,G., Ran,Y., Lopez,J.A. and Peng,Y.
Journal J. Biol. Chem. 286 (24), 21315-21323 (2011)
Title von Willebrand factor binding to platelet GpIb initiates signals for platelet activation .
Author Kroll,M.H., Harris,T.S., Moake,J.L., Handin,R.I. and Schafer,A.I.
Journal J. Clin. Invest. 88 (5), 1568-1573 (1991)
Title Human platelet glycoprotein IX. Characterization of cDNA and localization of the gene to chromosome 3 .
Author Hickey,M.J., Deaven,L.L. and Roth,G.J.
Journal FEBS Lett. 274 (1-2), 189-192 (1990)
Title Purification of botrocetin from Bothrops jararaca venom. Analysis of the botrocetin-mediated interaction between von Willebrand factor and the human platelet membrane glycoprotein Ib-IX complex .
Author Andrews,R.K., Booth,W.J., Gorman,J.J., Castaldi,P.A. and Berndt,M.C.
Journal Biochemistry 28 (21), 8317-8326 (1989)
Title Human platelet glycoprotein IX: an adhesive prototype of leucine-rich glycoproteins with flank-center-flank structures .
Author Hickey,M.J., Williams,S.A. and Roth,G.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (17), 6773-6777 (1989)
Title Glycoprotein Ib and glycoprotein IX are fully complexed in the intact platelet membrane .
Author Du,X., Beutler,L., Ruan,C., Castaldi,P.A. and Berndt,M.C.
Journal Blood 69 (5), 1524-1527 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878