• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glycoprotein IX (platelet) (GP9), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_000174 Homo sapiens glycoprotein IX (platelet) (GP9), mRNA. Full Lenth $248.82
ORF Sequence $159.00


RefSeq Version NM_000174.3, 208609983
Length 858 bp
Structure linear
Update Date 09-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens glycoprotein IX (platelet) (GP9), mRNA.
Product platelet glycoprotein IX precursor
Comment

Summary: This gene encodes a small membrane glycoprotein found on the surface of human platelets. It forms a 1-to-1 noncovalent complex with glycoprotein Ib, a platelet surface membrane glycoprotein complex that functions as a receptor for von Willebrand factor. The complete receptor complex includes noncovalent association of the alpha and beta subunits with the protein encoded by this gene and platelet glycoprotein V. Defects in this gene are a cause of Bernard-Soulier syndrome, also known as giant platelet disease. These patients have unusually large platelets and have a clinical bleeding tendency. [provided by RefSeq].

RefSeq NP_000165.1
CDS 188..721
Exon (1)1..49
Exon (2)1..49
Exon (3)50..175
Exon (4)176..858
Translation MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLAN NSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAA HGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
71+c, tdbSNP:35542024
207+c, tdbSNP:121918038
257+c, tdbSNP:28933378
297+a, gdbSNP:121918036
319+a, gdbSNP:6069
354+c, tdbSNP:28933377
369+a, gdbSNP:5030764
399+c, tdbSNP:121918037
561+a, gdbSNP:61734182
562+c, tdbSNP:61732506
641+a, gdbSNP:116821050
653+a, gdbSNP:3796130
728+c, tdbSNP:115005114
732+a, cdbSNP:13094659
Gene SymbolGP9
Gene SynonymCD42a; GPIX
Chromosome3
Locus Map3q21.3
All Transcripts NM_000174
Title The platelet glycoprotein Ib-IX-V complex anchors lipid rafts to the membrane skeleton: implications for activation-dependent cytoskeletal translocation of signaling molecules .
Author Munday,A.D., Gaus,K. and Lopez,J.A.
Journal J. Thromb. Haemost. 8 (1), 163-172 (2010)
Title Binding of platelet glycoprotein Ibbeta through the convex surface of leucine-rich repeats domain of glycoprotein IX .
Author Mo,X., Nguyen,N.X., McEwan,P.A., Zheng,X., Lopez,J.A., Emsley,J. and Li,R.
Journal J. Thromb. Haemost. 7 (9), 1533-1540 (2009)
Title Identification of five novel 14-3-3 isoforms interacting with the GPIb-IX complex in platelets .
Author Mangin,P.H., Receveur,N., Wurtz,V., David,T., Gachet,C. and Lanza,F.
Journal J. Thromb. Haemost. 7 (9), 1550-1555 (2009)
Title Intrinsic impaired proplatelet formation and microtubule coil assembly of megakaryocytes in a mouse model of Bernard-Soulier syndrome .
Author Strassel,C., Eckly,A., Leon,C., Petitjean,C., Freund,M., Cazenave,J.P., Gachet,C. and Lanza,F.
Journal Haematologica 94 (6), 800-810 (2009)
Title A large Swiss family with Bernard-Soulier syndrome - Correlation phenotype and genotype .
Author Zieger,B., Jenny,A., Tsakiris,D.A., Bartsch,I., Sandrock,K., Schubart,C., Schafer,S., Busse,A. and Wuillemin,W.A.
Journal Hamostaseologie 29 (2), 161-167 (2009)
Title von Willebrand factor binding to platelet GpIb initiates signals for platelet activation .
Author Kroll,M.H., Harris,T.S., Moake,J.L., Handin,R.I. and Schafer,A.I.
Journal J. Clin. Invest. 88 (5), 1568-1573 (1991)
Title Human platelet glycoprotein IX. Characterization of cDNA and localization of the gene to chromosome 3 .
Author Hickey,M.J., Deaven,L.L. and Roth,G.J.
Journal FEBS Lett. 274 (1-2), 189-192 (1990)
Title Purification of botrocetin from Bothrops jararaca venom. Analysis of the botrocetin-mediated interaction between von Willebrand factor and the human platelet membrane glycoprotein Ib-IX complex .
Author Andrews,R.K., Booth,W.J., Gorman,J.J., Castaldi,P.A. and Berndt,M.C.
Journal Biochemistry 28 (21), 8317-8326 (1989)
Title Human platelet glycoprotein IX: an adhesive prototype of leucine-rich glycoproteins with flank-center-flank structures .
Author Hickey,M.J., Williams,S.A. and Roth,G.J.
Journal Proc. Natl. Acad. Sci. U.S.A. 86 (17), 6773-6777 (1989)
Title Glycoprotein Ib and glycoprotein IX are fully complexed in the intact platelet membrane .
Author Du,X., Beutler,L., Ruan,C., Castaldi,P.A. and Berndt,M.C.
Journal Blood 69 (5), 1524-1527 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878