• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens mutS homolog 6 (E. coli) (MSH6), mRNA.


RefSeq Accession Definition Services Price Order
NM_000179 Homo sapiens mutS homolog 6 (E. coli) (MSH6), mRNA. ORF Sequence $1429.05
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000179.2, 157426894
Length 4435 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens mutS homolog 6 (E. coli) (MSH6), mRNA.
Product DNA mismatch repair protein Msh6
Comment

Summary: This gene encodes a protein similar to the MutS protein. In E. coli, the MutS protein helps in the recognition of mismatched nucleotides, prior to their repair. A highly conserved region of approximately 150 aa, called the Walker-A adenine nucleotide binding motif, exists in MutS homologs. The encoded protein of this gene combines with MSH2 to form a mismatch recognition complex that functions as a bidirectional molecular switch that exchanges ADP and ATP as DNA mismatches are bound and dissociated. Mutations in this gene have been identified in individuals with hereditary nonpolyposis colon cancer (HNPCC) and endometrial cancer. [provided by RefSeq, Jul 2008].

RefSeq NP_000170.1
CDS 153..4235
Misc Feature(1)15..17
Misc Feature(2)15..17
Misc Feature(3)192..194
Misc Feature(4)192..194
Misc Feature(5)273..275
Misc Feature(6)279..281
Misc Feature(7)360..362
Misc Feature(8)387..389
Misc Feature(9)414..737
Misc Feature(10)423..425
Misc Feature(11)order(450..452,459..461,468..470,549..551,561..563,
Misc Feature(12)561..563
Misc Feature(13)561..563
Misc Feature(14)561..563
Misc Feature(15)567..569
Misc Feature(16)582..584
Misc Feature(17)750..752
Misc Feature(18)807..809
Misc Feature(19)807..809
Misc Feature(20)831..833
Misc Feature(21)831..833
Misc Feature(22)906..908
Misc Feature(23)906..908
Misc Feature(24)912..914
Misc Feature(25)912..914
Misc Feature(26)918..920
Misc Feature(27)918..920
Misc Feature(28)933..935
Misc Feature(29)933..935
Misc Feature(30)957..959
Misc Feature(31)972..974
Misc Feature(32)975..977
Misc Feature(33)987..989
Misc Feature(34)990..992
Misc Feature(35)1077..1079
Misc Feature(36)1194..1196
Misc Feature(37)1371..4139
Misc Feature(38)1371..1727
Misc Feature(39)1662..1664
Misc Feature(40)1764..2231
Misc Feature(41)2640..2642
Misc Feature(42)2640..2642
Misc Feature(43)2922..2924
Misc Feature(44)2946..3224
Misc Feature(45)3372..4127
Misc Feature(46)3552..3575
Misc Feature(47)order(3561..3566,3570..3578,3684..3686,3789..3794,
Misc Feature(48)3675..3686
Misc Feature(49)3699..3740
Misc Feature(50)3777..3794
Misc Feature(51)3801..3812
Misc Feature(52)3882..3902
Exon (1)1..412
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Exon (2)413..609
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Exon (3)610..779
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Exon (4)780..3324
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Exon (5)3325..3590
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Exon (6)3591..3708
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Exon (7)3709..3798
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Exon (8)3799..3953
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Exon (9)3954..4153
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Exon (10)4154..4328
Gene:MSH6
Gene Synonym:GTBP; HNPCC5; HSAP
Translation MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPL ARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI REKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRAD EALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRR SSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR KRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSS RPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQN FDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKV ARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSENYSKYLL SLKEKEEDSSGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGN LSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVMLPQVLK GMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTT RSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCA PLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDS RAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQTKNPEG RFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRN RIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLIN AEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIL LPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIGCEEEEQENGKAYCVLVTGPNMGGK STLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASI LMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNV AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKA REFEKMNQSLRLFREVCLASERSTVDAEAVHKLLTLIKEL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
104+c, tdbSNP:113081858
115+c, gdbSNP:185538282
135+g, tdbSNP:199913053
168+a, cdbSNP:200944853
177+a, gdbSNP:41294986
190+a, cdbSNP:41294988
211+a, c, tdbSNP:63750664
214+a, gdbSNP:267608025
225+g, tdbSNP:267608026
226+c, tdbSNP:35462442
254+a, cdbSNP:201132087
259+c, tdbSNP:61756469
260+g, tdbSNP:63750213
268+c, tdbSNP:1042821
276+c, tdbSNP:34014629
313+c, gdbSNP:63751098
330+c, tdbSNP:35819209
338+g, tdbSNP:1042820
346+c, tdbSNP:41294984
395+g, tdbSNP:11548644
428+dbSNP:
428+a, gdbSNP:1800932
449+g, tdbSNP:63751258
510+a, gdbSNP:146455343
516+a, gdbSNP:143036974
535+g, tdbSNP:63750143
536+, tdbSNP:63750374
578+a, gdbSNP:63750342
583+a, cdbSNP:3211299
592+a, tdbSNP:63750525
619+dbSNP:
619+c, gdbSNP:63749873
628+c, tdbSNP:138472840
635+a, gdbSNP:63751030
643+a, cdbSNP:146469162
674..675+, agdbSNP:267608037
692+c, tdbSNP:1800935
705+a, gdbSNP:193922344
735+g, tdbSNP:267608038
739+g, tdbSNP:78939940
741+c, gdbSNP:148517241
751+a, cdbSNP:63751077
781+dbSNP:
781+c, tdbSNP:201431515
794+a, c, tdbSNP:1800937
795+a, gdbSNP:145959653
800..801+ag, ttdbSNP:63750471
801..802+, tdbSNP:267607692
803..804+, tdbSNP:63750955
812+a, cdbSNP:1800938
815+a, c, gdbSNP:41557217
850+c, gdbSNP:142949377
858+c, tdbSNP:63750996
870+c, tdbSNP:63750019
882+c, tdbSNP:267608066
885+a, tdbSNP:142500849
891..892+, tdbSNP:63750733
893+, adbSNP:267608041
894+c, tdbSNP:63749980
899+a, gdbSNP:63750372
907+c, gdbSNP:267608048
914..915+, tgdbSNP:267608072
946+g, tdbSNP:63749890
961+a, tdbSNP:200898010
966+g, tdbSNP:63750552
997..998+, tdbSNP:267608062
1006+g, tdbSNP:63750878
1018..1019+aa, gcdbSNP:267608079
1019+a, cdbSNP:267608047
1036+a, gdbSNP:267608051
1044+c, tdbSNP:146816935
1051+c, gdbSNP:55760494
1094+c, gdbSNP:150440246
1096+c, tdbSNP:63750491
1105..1106+, adbSNP:66538742
1108+c, tdbSNP:188252826
1110+a, cdbSNP:138145453
1127+a, gdbSNP:193922345
1136+c, tdbSNP:138143769
1171+c, tdbSNP:61753793
1183+, adbSNP:67883924
1205+c, tdbSNP:28903083
1230+a, gdbSNP:145994565
1231+g, tdbSNP:267608060
1234+a, gdbSNP:63750440
1237+, cdbSNP:267608056
1251+a, cdbSNP:201193496
1287..1291+, agagadbSNP:267608077
1293+a, gdbSNP:142111387
1305..1307+, aggdbSNP:267608043
1314..1315+, cdbSNP:34013967
1316+c, tdbSNP:55708305
1319+a, g, tdbSNP:1042819
1320+a, gdbSNP:147737737
1322+c, tdbSNP:55882234
1331+a, tdbSNP:144961390
1338+c, gdbSNP:2020908
1342..1343+, atdbSNP:63750439
1342+a, gdbSNP:63750065
1346+a, gdbSNP:148116863
1383+a, tdbSNP:202219685
1409+a, gdbSNP:63750026
1424+c, gdbSNP:63751452
1425+a, gdbSNP:63749971
1447..1448+gca, ttdbSNP:267608080
1451+a, tdbSNP:267608055
1456+c, tdbSNP:63751405
1492..1493+, gdbSNP:34248409
1497+c, tdbSNP:3136333
1498+c, tdbSNP:63750741
1516+a, cdbSNP:200938360
1521+c, gdbSNP:267608052
1542+a, tdbSNP:201892477
1555+a, gdbSNP:41295268
1573..1574+, tdbSNP:63750348
1574..1575+, tgdbSNP:63750854
1577+c, gdbSNP:61754782
1578+a, gdbSNP:138558010
1596+c, tdbSNP:63750909
1601+c, g, tdbSNP:35590297
1626+a, gdbSNP:61754783
1629+g, tdbSNP:267608046
1645+a, gdbSNP:147136417
1660+c, gdbSNP:63750897
1678+c, tdbSNP:63751005
1714+c, tdbSNP:149159527
1717+a, gdbSNP:63751009
1732+, tdbSNP:63751090
1743+a, cdbSNP:201721694
1754+, cdbSNP:63751234
1765+a, cdbSNP:728619
1766..1767+ag, tcdbSNP:267608049
1766+g, tdbSNP:63750870
1770+a, cdbSNP:201996928
1784..1787+, aaaadbSNP:267608064
1786..1789+, aagadbSNP:63749874
1788+c, gdbSNP:63751172
1789..1790+, agdbSNP:267608076
1798+c, gdbSNP:200447622
1817+a, gdbSNP:146785465
1819+a, tdbSNP:63751312
1828+a, gdbSNP:63750595
1829+c, tdbSNP:63749893
1848+a, gdbSNP:63749973
1860+a, gdbSNP:61748081
1891+c, tdbSNP:41295270
1898+g, tdbSNP:201518545
1922+c, tdbSNP:267608070
1923+c, tdbSNP:267608045
1928+a, g, tdbSNP:56132616
1936+, tdbSNP:267608050
1939+, tdbSNP:267608044
1958..1961+, aaagdbSNP:63750735
1974+a, gdbSNP:201613780
1982+a, g, tdbSNP:201735525
1987+a, cdbSNP:63750564
2009+a, cdbSNP:63751121
2018+a, tdbSNP:1042817
2019+, cdbSNP:71539659
2019+c, gdbSNP:3136334
2020+c, tdbSNP:63750462
2021+c, tdbSNP:141242295
2027+c, tdbSNP:63749886
2046+, adbSNP:67281404
2053..2054+, tgdbSNP:267608082
2053+a, tdbSNP:63751097
2067+a, gdbSNP:143517321
2074+, adbSNP:66708018
2084+c, gdbSNP:34938432
2089+a, gdbSNP:201096652
2104+c, tdbSNP:144823143
2112..2113+, gtgadbSNP:63751167
2114+a, gdbSNP:148592158
2151+c, gdbSNP:151086192
2160+a, gdbSNP:63749857
2179+a, gdbSNP:143643688
2197..2198+, ctdbSNP:267608057
2197+c, gdbSNP:140472824
2206+c, gdbSNP:63750358
2213+a, tdbSNP:267608068
2214..2215+, gtdbSNP:63750075
2231..2232+, adbSNP:267608083
2244+a, c, gdbSNP:63750832
2257+c, gdbSNP:63751419
2302..2305+, tcagdbSNP:267608058
2311+c, tdbSNP:185531778
2317..2337+, ctggtgctatcttcaccaaagdbSNP:63749941
2325+a, gdbSNP:148898662
2327+c, gdbSNP:63750304
2328..2329+ag, ttdbSNP:63750136
2335+a, cdbSNP:35552856
2343+c, tdbSNP:63751442
2346+c, tdbSNP:63751127
2391+c, tdbSNP:63751305
2405+c, tdbSNP:2020913
2420+a, gdbSNP:142246608
2423+c, gdbSNP:142172006
2424+c, tdbSNP:56371757
2433+a, gdbSNP:199876321
2441+c, tdbSNP:137946937
2447+c, gdbSNP:63750985
2454..2456+, cctdbSNP:63750647
2454+c, gdbSNP:35946687
2466+c, tdbSNP:63750138
2467+a, gdbSNP:63750725
2471+c, tdbSNP:63749895
2481+a, tdbSNP:267608067
2491+c, gdbSNP:63749899
2500..2501+, gtdbSNP:267608065
2512+c, tdbSNP:63750637
2536+c, tdbSNP:202127474
2541+, gdbSNP:63751095
2550+c, gdbSNP:61748083
2551+c, tdbSNP:63750895
2552+c, tdbSNP:267608071
2560+a, gdbSNP:63751450
2564+a, gdbSNP:201460265
2577+, gdbSNP:63751053
2619+a, gdbSNP:267608032
2643+c, gdbSNP:267608053
2655+c, tdbSNP:63751321
2701+a, gdbSNP:63750389
2713+a, tdbSNP:34374438
2749+a, cdbSNP:190075874
2752+g, tdbSNP:139598980
2766..2767+, attadbSNP:63750357
2785+c, tdbSNP:2020912
2793+aaaa, gdbSNP:63751408
2808+a, gdbSNP:2020914
2813+g, tdbSNP:267608069
2819+g, tdbSNP:149945495
2825+c, gdbSNP:146006741
2826+, tdbSNP:63750982
2852+a, tdbSNP:1042816
2854+a, gdbSNP:63749889
2871..2872+, gtdbSNP:63750904
2872+c, tdbSNP:201936512
2876+a, gdbSNP:35389622
2883+c, tdbSNP:63751017
2891+c, tdbSNP:63750056
2920..2921+, adbSNP:267608063
2967+c, tdbSNP:63750140
2975..2977+, tgcdbSNP:63750025
2979+g, tdbSNP:143520357
3003..3010+, ctcctggadbSNP:63750940
3056+c, gdbSNP:150683226
3058+a, gdbSNP:63749919
3077+c, tdbSNP:139026662
3079+a, gdbSNP:63751113
3083+c, gdbSNP:63750111
3102+a, cdbSNP:146359682
3107+c, gdbSNP:63750942
3114+c, tdbSNP:61753795
3115+g, tdbSNP:115386788
3116+a, cdbSNP:144288981
3135+g, tdbSNP:63750258
3136+, adbSNP:63749938
3165+c, tdbSNP:63750563
3180..3184+, actatdbSNP:63750369
3190+a, cdbSNP:200837944
3192..3194+, aagdbSNP:267608073
3204..3205+, ctdbSNP:63751407
3214+a, cdbSNP:63750287
3219+g, tdbSNP:267608059
3228+g, tdbSNP:267608054
3244+a, tdbSNP:63750804
3253+a, gdbSNP:181727939
3255+c, tdbSNP:63749999
3271..3272+, ttdbSNP:267608042
3294+c, gdbSNP:200492211
3307..3308+, agdbSNP:63750833
3312+a, tdbSNP:267608075
3314+c, tdbSNP:149605979
3328+dbSNP:
3328+c, tdbSNP:182292083
3334+, tdbSNP:63750196
3347..3350+, ctatdbSNP:267608085
3347+, cdbSNP:63750714
3350+c, tdbSNP:199643502
3351..3352+, tadbSNP:63749821
3354+c, g, tdbSNP:63749843
3358+a, gdbSNP:63750784
3359+g, tdbSNP:267608074
3369+c, tdbSNP:142254875
3373+, tdbSNP:267608090
3378+c, tdbSNP:63750617
3396+c, tdbSNP:186240214
3397+c, tdbSNP:191109849
3398+a, g, tdbSNP:3136351
3411+a, c, g, tdbSNP:63750998
3412+c, gdbSNP:63750753
3413..3414+, c, ccdbSNP:267608087
3413+, cdbSNP:267608078
3415..3416+, tdbSNP:267608091
3416+c, tdbSNP:35621414
3417+c, tdbSNP:34490141
3420+a, gdbSNP:143477948
3425..3426+, tdbSNP:267608095
3436+a, gdbSNP:63750253
3451+c, g, tdbSNP:63750442
3458+a, tdbSNP:2020910
3463..3464+, ttdbSNP:267608092
3464+, tdbSNP:267608093
3472+, adbSNP:63750377
3476..3477+, tdbSNP:267608088
3490+c, tdbSNP:41295272
3506+a, gdbSNP:35642130
3507+g, tdbSNP:267608084
3512+a, gdbSNP:146737457
3519+g, tdbSNP:267608086
3551+c, tdbSNP:61748084
3567+a, gdbSNP:63751063
3571+a, gdbSNP:63750969
3577+c, tdbSNP:267608089
3588+c, tdbSNP:63750356
3594+dbSNP:
3594+c, gdbSNP:63750257
3624+c, tdbSNP:63750157
3639..3640+, ctgdbSNP:63751427
3640+a, tdbSNP:63750252
3641..3642+, ctgdbSNP:63750359
3663..3668+gataga, tdbSNP:63751198
3663..3664+, gadbSNP:63751410
3665..3666+, tadbSNP:63750194
3665+c, tdbSNP:63749834
3666..3667+, adbSNP:63751327
3668..3679+, agtgtttactagdbSNP:63749952
3668..3671+, agtgdbSNP:267608099
3671..3672+, adbSNP:63750296
3674..3675+, gtttdbSNP:267608101
3689+c, gdbSNP:200120044
3695+c, gdbSNP:267608100
3710..3717+dbSNP:
3710..3717+, tgaaagtadbSNP:267608108
3712+a, gdbSNP:150632241
3729+a, gdbSNP:63751328
3733..3734+, tdbSNP:267608107
3738+a, gdbSNP:75095286
3753+c, tdbSNP:182024561
3759..3762+, catgdbSNP:267608040
3787..3788+, tdbSNP:63750731
3793+a, cdbSNP:63750914
3797+a, gdbSNP:267608113
3802+dbSNP:
3802+a, gdbSNP:63749898
3808+c, tdbSNP:63750949
3826+c, tdbSNP:63750370
3846+c, gdbSNP:41295276
3849..3852+, aaagdbSNP:267608115
3851..3854+, agaadbSNP:193922343
3852+c, gdbSNP:35717727
3858..3859+, aatagcaaatgcagttgttaaagaacttgdbSNP:63750523
3876..3878+, cgtdbSNP:63749942
3877+g, tdbSNP:63750119
3879+a, tdbSNP:147453999
3894+c, gdbSNP:63750882
3909+c, gdbSNP:187491488
3910+a, tdbSNP:202066386
3920+g, tdbSNP:63751058
3924+c, g, tdbSNP:63750554
3930+a, gdbSNP:63750673
3940+a, gdbSNP:147852216
3951..3952+, atdbSNP:267608114
3952+c, tdbSNP:148445930
3956..3957+dbSNP:
3956..3957+, adbSNP:267608118
3970+a, gdbSNP:201830316
3976..3977+, aatgdbSNP:63750262
3976+a, gdbSNP:150990541
3985+c, gdbSNP:201191389
3990+c, tdbSNP:63750139
3992..3998+, ggagactdbSNP:63751319
3999+a, gdbSNP:144714869
4002..4003+, attadbSNP:267608128
4003+c, tdbSNP:63750836
4004+a, g, tdbSNP:2229018
4039..4045+, aaagctadbSNP:267608130
4059+a, gdbSNP:63751064
4060+c, gdbSNP:201060668
4063+c, tdbSNP:34625968
4082+c, gdbSNP:267608129
4085+a, cdbSNP:143331529
4087..4088+, aagtdbSNP:267608127
4088+c, tdbSNP:61753796
4093..4094+, ttcadbSNP:267608126
4108..4111+, aagcdbSNP:267608119
4109..4110+, tcaaaagggacatagaaaadbSNP:63750767
4110..4113+, gcaadbSNP:267608123
4111..4114+, caagdbSNP:267608120
4113+a, gdbSNP:41295278
4115+a, tdbSNP:267608125
4130+a, gdbSNP:141464646
4136..4137+, atcadbSNP:267608124
4138+c, tdbSNP:199594809
4139..4140+, gtcadbSNP:267608121
4143+c, tdbSNP:267608094
4144+g, tdbSNP:184131049
4153+a, gdbSNP:267608122
4163+dbSNP:
4163+c, tdbSNP:139825189
4166+c, gdbSNP:61748086
4210+g, tdbSNP:56238300
4213+a, tdbSNP:267608140
4216..4217+, gtcadbSNP:267608141
4217..4218+, ttgadbSNP:55740729
4220+c, gdbSNP:192740549
4221..4222+, ttgadbSNP:267608142
4223..4224+, gattdbSNP:3136368
4224+a, gdbSNP:199739099
4227+g, tdbSNP:267608081
4258+a, gdbSNP:200412142
4269+c, gdbSNP:184571812
4319+a, tdbSNP:267608143
4320+a, tdbSNP:2020906
Gene SymbolMSH6
Gene SynonymGTBP; HNPCC5; HSAP
Chromosome2
Locus Map2p16
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000179 Homo sapiens mutS homolog 6 (E. coli) (MSH6), mRNA. Full Length $1552.25
ORF Sequence $1429.05
Title Benzo[alpha]pyrene repressed DNA mismatch repair in human breast cancer cells .
Author Chen,Y., Huang,C., Bai,C., Gao,H., Ma,R., Liu,X. and Dong,Q.
Journal Toxicology 304, 167-172 (2013)
Title Sub-cellular localization analysis of MSH6 missense mutations does not reveal an overt MSH6 nuclear transport impairment .
Author Belvederesi,L., Bianchi,F., Loretelli,C., Bracci,R., Cascinu,S. and Cellerino,R.
Journal Fam. Cancer 11 (4), 675-680 (2012)
Title Engineered disulfide-forming amino acid substitutions interfere with a conformational change in the mismatch recognition complex Msh2-Msh6 required for mismatch repair .
Author Hargreaves,V.V., Putnam,C.D. and Kolodner,R.D.
Journal J. Biol. Chem. 287 (49), 41232-41244 (2012)
Title Status of mismatch repair genes hMSH2 and hMSH6 in colorectal cancer in Saudi patients: an immunohistochemical analysis .
Author Alkhalidi,H. and Kfoury,H.
Journal East. Mediterr. Health J. 18 (11), 1114-1117 (2012)
Title MSH6 mutation in a family affected by Muir-Torre syndrome .
Author Kacerovska,D., Cerna,K., Martinek,P., Grossmann,P., Michal,M., Ricar,J. and Kazakov,D.V.
Journal Am J Dermatopathol 34 (6), 648-652 (2012)
Title Mutation of MSH3 in endometrial cancer and evidence for its functional role in heteroduplex repair .
Author Risinger,J.I., Umar,A., Boyd,J., Berchuck,A., Kunkel,T.A. and Barrett,J.C.
Journal Nat. Genet. 14 (1), 102-105 (1996)
Title Molecular cloning of the N-terminus of GTBP .
Author Nicolaides,N.C., Palombo,F., Kinzler,K.W., Vogelstein,B. and Jiricny,J.
Journal Genomics 31 (3), 395-397 (1996)
Title Mutations of GTBP in genetically unstable cells .
Author Papadopoulos,N., Nicolaides,N.C., Liu,B., Parsons,R., Lengauer,C., Palombo,F., D'Arrigo,A., Markowitz,S., Willson,J.K., Kinzler,K.W. et al.
Journal Science 268 (5219), 1915-1917 (1995)
Title GTBP, a 160-kilodalton protein essential for mismatch-binding activity in human cells .
Author Palombo,F., Gallinari,P., Iaccarino,I., Lettieri,T., Hughes,M., D'Arrigo,A., Truong,O., Hsuan,J.J. and Jiricny,J.
Journal Science 268 (5219), 1912-1914 (1995)
Title Isolation of an hMSH2-p160 heterodimer that restores DNA mismatch repair to tumor cells .
Author Drummond,J.T., Li,G.M., Longley,M.J. and Modrich,P.
Journal Science 268 (5219), 1909-1912 (1995)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878