• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens glucuronidase, beta (GUSB), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000181 Homo sapiens glucuronidase, beta (GUSB), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $639.00 $590.00 15

*Business Day

Related Services

RefSeq Version NM_000181.3, 268834191
Length 2321 bp
Structure linear
Update Date 29-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens glucuronidase, beta (GUSB), transcript variant 1, mRNA.
Product beta-glucuronidase isoform 1 precursor
Comment

Summary: This gene encodes a hydrolase that degrades glycosaminoglycans, including heparan sulfate, dermatan sulfate, and chondroitin-4,6-sulfate. The enzyme forms a homotetramer that is localized to the lysosome. Mutations in this gene result in mucopolysaccharidosis type VII. Alternative splicing results in multiple transcript variants. There are many pseudogenes of this locus in the human genome.[provided by RefSeq, May 2014].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_000172.2
CDS 132..2087
Misc Feature(1)6
Misc Feature(2)6
Misc Feature(3)89..105
Misc Feature(4)93..95
Misc Feature(5)102
Misc Feature(6)210..2024
Misc Feature(7)234..803
Misc Feature(8)807..1112
Misc Feature(9)1116..2024
Exon (1)1..341
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (2)342..527
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (3)528..712
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (4)713..855
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (5)856..1043
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (6)1044..1196
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (7)1197..1375
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (8)1376..1522
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (9)1523..1607
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (10)1608..1784
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (11)1785..1920
Gene:GUSB
Gene Synonym:BG; MPS7
Exon (12)1921..2300
Gene:GUSB
Gene Synonym:BG; MPS7
Translation MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFE EQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVV LRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTT LPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQD SGLVNYQISVKGSNLFKLEVRLLDAENKVVANGTGTQGQLKVPGVSLWWPYLMHERPAYL YSLEVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKG FDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLALPQFFNN VSLHHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKSLDPSRPVT FVSNSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSE YGAETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTR VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSLFT
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(60)-c, adbSNP:2279904
complement(82)-g, adbSNP:201504866
complement(90)-c, adbSNP:199591754
complement(120)-t, cdbSNP:2279903
complement(144)-g, adbSNP:190496263
complement(153)-c, adbSNP:376505707
complement(278)-g, adbSNP:375940373
complement(288)-t, cdbSNP:371314015
complement(293)-g, adbSNP:74975849
complement(297)-g, adbSNP:147262894
complement(347)-dbSNP:
complement(347)-g, adbSNP:77774169
complement(353)-g, adbSNP:140016611
complement(392)-g, adbSNP:112435030
397+a, gdbSNP:398123236
complement(403)-t, cdbSNP:147454954
426+a, gdbSNP:398123237
complement(462)-c, adbSNP:200935970
complement(542)-dbSNP:
complement(542)-g, adbSNP:141441283
complement(560)-t, cdbSNP:375740757
573+c, tdbSNP:121918177
complement(578)-g, adbSNP:148364905
complement(584)-g, cdbSNP:144397476
complement(585)-t, cdbSNP:149606212
complement(645)-t, cdbSNP:369537067
663+a, cdbSNP:11559281
complement(671)-g, adbSNP:138435796
complement(692)-t, cdbSNP:74430256
complement(714)-dbSNP:
complement(714)-g, adbSNP:372083359
complement(744)-g, adbSNP:367989163
complement(759)-t, adbSNP:200457516
complement(764)-g, adbSNP:140278510
777+c, tdbSNP:121918174
complement(800)-t, adbSNP:201178083
complement(815)-t, gdbSNP:375590538
complement(826)-g, cdbSNP:138618819
complement(828)-t, cdbSNP:202210104
complement(840)-t, cdbSNP:373800055
complement(853)-t, cdbSNP:200298579
complement(891)-dbSNP:
complement(891)-t, gdbSNP:150086524
complement(895)-t, adbSNP:140709901
complement(897)-g, adbSNP:200941434
complement(913)-t, cdbSNP:373590814
complement(943)-g, adbSNP:369465888
complement(944)-t, cdbSNP:150999162
997+a, gdbSNP:398123238
complement(1001)-t, cdbSNP:377665214
complement(1049)-dbSNP:
complement(1049)-c, adbSNP:375828604
complement(1063)-g, adbSNP:371554909
complement(1064)-t, cdbSNP:188921177
complement(1072)-g, cdbSNP:376068646
complement(1092)-t, cdbSNP:375970959
complement(1094)-t, cdbSNP:142706520
complement(1151)-t, cdbSNP:372851133
complement(1156)-t, gdbSNP:368189360
complement(1172)-g, adbSNP:141303888
complement(1175)-g, adbSNP:147820162
1181+a, c, gdbSNP:121918182
complement(1182)-g, adbSNP:191153460
complement(1187)-t, cdbSNP:200412277
1192+c, tdbSNP:121918175
1200+dbSNP:
1200+c, tdbSNP:121918185
complement(1214)-g, adbSNP:139976112
1215+a, gdbSNP:398123234
complement(1241)-g, cdbSNP:374490058
1257+c, tdbSNP:11559283
complement(1257)-g, adbSNP:386519327
complement(1265)-g, adbSNP:374755881
complement(1268)-g, adbSNP:371271170
complement(1269)-t, cdbSNP:377615121
complement(1273)-g, adbSNP:74410123
1275+c, tdbSNP:121918173
complement(1278)-t, gdbSNP:200451572
1300+a, gdbSNP:398123235
complement(1313)-t, cdbSNP:369190724
complement(1316)-c, adbSNP:149761698
complement(1326)-g, adbSNP:376589676
complement(1343)-g, adbSNP:375214425
complement(1344)-t, cdbSNP:200149500
complement(1371)-g, adbSNP:150686327
complement(1373)-g, cdbSNP:367551992
1384+dbSNP:
1384+g, tdbSNP:193920810
complement(1416)-t, cdbSNP:376131143
complement(1422)-t, cdbSNP:143040697
complement(1428)-t, cdbSNP:369767887
1450..1451+, cdbSNP:35957142
complement(1454)-g, adbSNP:368144710
complement(1460)-g, adbSNP:139776224
1469+a, gdbSNP:121918180
complement(1481)-g, adbSNP:376567545
complement(1490)-t, cdbSNP:118066970
complement(1547)-dbSNP:
complement(1547)-g, adbSNP:138554083
complement(1592)-g, adbSNP:200831987
complement(1601)-g, adbSNP:143084006
complement(1611)-dbSNP:
complement(1611)-g, cdbSNP:143495981
1615+a, gdbSNP:121918178
1652+a, gdbSNP:121918179
complement(1658)-g, adbSNP:201928248
complement(1663)-t, cdbSNP:199694121
complement(1748)-g, adbSNP:377519272
complement(1751)-t, cdbSNP:368053364
complement(1825)-dbSNP:
complement(1825)-c, adbSNP:149448152
1861+g, tdbSNP:121918183
complement(1871)-t, cdbSNP:41406646
1871+c, tdbSNP:1061361
complement(1872)-t, cdbSNP:150304382
complement(1877)-g, adbSNP:373819742
complement(1883)-t, cdbSNP:141430018
complement(1901)-t, gdbSNP:200228580
complement(1908)-t, cdbSNP:113059520
1962+dbSNP:
1962+c, tdbSNP:121918176
1976+, adbSNP:35302712
1987+c, tdbSNP:121918172
complement(2005)-t, cdbSNP:372550726
2012+g, tdbSNP:121918184
complement(2037)-g, adbSNP:145910162
complement(2048..2049)-, ctadbSNP:375972976
complement(2072..2073)-, gdbSNP:372007777
complement(2077)-t, cdbSNP:386623211
2077+c, tdbSNP:9530
complement(2091)-t, adbSNP:201204553
complement(2107)-g, adbSNP:150311243
complement(2121)-g, cdbSNP:62470933
complement(2142)-g, adbSNP:372605666
complement(2248)-t, cdbSNP:140236850
complement(2259)-, tdbSNP:372865986
complement(2259)-t, cdbSNP:77293332
complement(2281)-t, cdbSNP:138519677
complement(2295)-c, adbSNP:190201470
Gene SymbolGUSB
Gene SynonymBG; MPS7
Chromosome7
Locus Map7q21.11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000181 Homo sapiens glucuronidase, beta (GUSB), transcript variant 1, mRNA. In-stock $639.00 $590.00 15
NM_001284290 Homo sapiens glucuronidase, beta (GUSB), transcript variant 2, mRNA. On-demand $699.00 18
NM_001293104 Homo sapiens glucuronidase, beta (GUSB), transcript variant 3, mRNA. On-demand $699.00 18
NM_001293105 Homo sapiens glucuronidase, beta (GUSB), transcript variant 4, mRNA. On-demand $699.00 18
XM_005250297 PREDICTED: Homo sapiens glucuronidase, beta (GUSB), transcript variant X1, mRNA. On-demand $849.00 20
Title Relationship between the expression of CES2, UGT1A1, and GUSB in colorectal cancer tissues and aberrant methylation .
Author Xie,F.W., Peng,Y., Chen,X., Chen,X., Li,J., Wang,W., Yu,Z. and Ouyang,X.
Journal Neoplasma 61 (1), 99-109 (2014)
Title GUSB and ATP2B4 are suitable reference genes for CFTR gene expression data normalization in nasal epithelium cells .
Author Masvidal L, Alvarez A, Ruano L, de Gracia J, Larriba S and Casals T.
Journal J. Cyst. Fibros. 11 (5), 398-404 (2012)
Title Expression of common housekeeping genes is affected by disease in human hepatitis C virus-infected liver .
Author Congiu M, Slavin JL and Desmond PV.
Journal Liver Int. 31 (3), 386-390 (2011)
Title Mutations and polymorphisms in GUSB gene in mucopolysaccharidosis .
Author Tomatsu S, Montano AM, Dung VC, Grubb JH and Sly WS.
Journal Hum. Mutat. 30 (4), 511-519 (2009)
Title Large-scale proteomics and phosphoproteomics of urinary exosomes .
Author Gonzales PA, Pisitkun T, Hoffert JD, Tchapyjnikov D, Star RA, Kleta R, Wang NS and Knepper MA.
Journal J. Am. Soc. Nephrol. 20 (2), 363-379 (2009)
Title Reversal of pathology in murine mucopolysaccharidosis type VII by somatic cell gene transfer .
Author Wolfe JH, Sands MS, Barker JE, Gwynn B, Rowe LB, Vogler CA and Birkenmeier EH.
Journal Nature 360 (6406), 749-753 (1992)
Title Characterization of the subunits and sugar moiety of human placental and leukemic beta-glucuronidase .
Author Tanaka J, Gasa S, Sakurada K, Miyazaki T, Kasai M and Makita A.
Journal Biol. Chem. Hoppe-Seyler 373 (1), 57-62 (1992)
Title Analysis of the 5' flanking region of the human beta-glucuronidase gene .
Author Shipley JM, Miller RD, Wu BM, Grubb JH, Christensen SG, Kyle JW and Sly WS.
Journal Genomics 10 (4), 1009-1018 (1991)
Title Mucopolysaccharidosis type VII: characterization of mutations and molecular heterogeneity .
Author Tomatsu S, Fukuda S, Sukegawa K, Ikedo Y, Yamada S, Yamada Y, Sasaki T, Okamoto H, Kuwahara T and Yamaguchi S.
Journal Am. J. Hum. Genet. 48 (1), 89-96 (1991)
Title Human beta-glucuronidase deficiency mucopolysaccharidosis: identification of cross-reactive antigen in cultured fibroblasts of deficient patients by enzyme immunoassay .
Author Bell,C.E. Jr., Sly,W.S. and Brot,F.E.
Journal J. Clin. Invest. 59 (1), 97-105 (1977)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.