• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens hexokinase 2 (HK2), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000189 Homo sapiens hexokinase 2 (HK2), mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_000189.4, 40806188
Length 7109 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens hexokinase 2 (HK2), mRNA.
Product hexokinase-2
Comment

Summary: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009].

RefSeq NP_000180.2
CDS 1927..4680
Misc Feature(1)1783..1785
Misc Feature(2)1927..1962
Misc Feature(3)1927..1962
Misc Feature(4)1960..3306
Misc Feature(5)1963..3351
Misc Feature(6)2167..2715
Misc Feature(7)order(2176..2187,2191..2193,2197..2199,2551..2553,
Misc Feature(8)2176..2190
Misc Feature(9)2389..2394
Misc Feature(10)2440..2445
Misc Feature(11)2548..2553
Misc Feature(12)2593..3306
Misc Feature(13)2797..2808
Misc Feature(14)3163..3171
Misc Feature(15)3310..4650
Misc Feature(16)3352..4677
Misc Feature(17)3511..4023
Misc Feature(18)order(3520..3531,3535..3537,3541..3543,3895..3897,
Misc Feature(19)3520..3534
Misc Feature(20)3733..3738
Misc Feature(21)3784..3789
Misc Feature(22)3892..3897
Misc Feature(23)3937..4650
Misc Feature(24)3970..3975
Misc Feature(25)4141..4152
Misc Feature(26)4507..4515
Exon (1)1..1989
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (2)1990..2152
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (3)2153..2301
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (4)2302..2421
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (5)2422..2517
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (6)2518..2617
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (7)2618..2801
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (8)2802..2957
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (9)2958..3191
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (10)3192..3496
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (11)3497..3645
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (12)3646..3765
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (13)3766..3861
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (14)3862..3961
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (15)3962..4145
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (16)4146..4301
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (17)4302..4535
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (18)4536..7093
Gene:HK2
Gene Synonym:HKII; HXK2
Translation MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAA VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV EGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYME EMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM YMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLG LDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH PHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLS HDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV LLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF TFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG TMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDD FRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA VVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG AALITAVACRIREAGQR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
148+c, gdbSNP:114606216
184+c, tdbSNP:79280243
274+a, gdbSNP:191326320
318+a, gdbSNP:656489
434+g, tdbSNP:138466922
506+a, gdbSNP:28362959
694+a, gdbSNP:11556193
696+a, gdbSNP:6741953
780+c, tdbSNP:141088257
1074+c, tdbSNP:113962612
1089..1090+, ctdbSNP:3832165
1185+c, tdbSNP:57969488
1431+a, tdbSNP:3732302
1449+c, gdbSNP:28362960
1694+c, gdbSNP:11556194
1905+c, tdbSNP:199694507
1938+a, gdbSNP:150568013
1978+c, gdbSNP:201636455
1995+dbSNP:
1995+c, tdbSNP:200787018
2015+a, gdbSNP:142756990
2057+a, gdbSNP:201380686
2097+c, tdbSNP:139553168
2125..2126+, tdbSNP:35614058
2134+a, tdbSNP:200036720
2220+dbSNP:
2220+a, gdbSNP:143863592
2242+a, gdbSNP:142433390
2265+c, tdbSNP:192335098
2352+dbSNP:
2352+a, tdbSNP:2229621
2373+a, tdbSNP:112341087
2376..2377+, gdbSNP:35250889
2391+a, gdbSNP:61755708
2418+c, tdbSNP:149112391
2427+dbSNP:
2427+c, tdbSNP:138918973
2484+a, gdbSNP:147398307
2494+c, tdbSNP:141663207
2495+a, gdbSNP:139442407
2529+dbSNP:
2529+c, tdbSNP:146408073
2538+c, gdbSNP:28363005
2541..2542+, gggggggggdbSNP:143351537
2543+g, tdbSNP:139726144
2660+dbSNP:
2660+c, tdbSNP:144438174
2679+c, tdbSNP:2229622
2694+c, tdbSNP:151250266
2716+c, tdbSNP:147035224
2733+a, gdbSNP:202135697
2740+a, gdbSNP:141419754
2746+c, tdbSNP:28363006
2777+a, gdbSNP:182426373
2828+dbSNP:
2828+a, gdbSNP:199736350
2838+a, gdbSNP:28363014
2866+c, gdbSNP:28363015
2888+c, g, tdbSNP:36066402
2892+a, gdbSNP:143931243
2918+c, tdbSNP:28363016
2919+c, tdbSNP:61751209
2920+c, tdbSNP:35677390
2974+dbSNP:
2974+c, tdbSNP:147658100
2983+c, tdbSNP:61748096
2999+a, gdbSNP:201385411
3021+g, tdbSNP:35396457
3043+c, tdbSNP:199992983
3072+c, tdbSNP:200608341
3085+g, tdbSNP:28363029
3087+a, gdbSNP:138547217
3100+a, gdbSNP:145270085
3216+dbSNP:
3216+c, tdbSNP:143068594
3220+c, tdbSNP:148796379
3232+c, tdbSNP:150873116
3243+c, tdbSNP:17847160
3319+c, gdbSNP:113525671
3329+a, gdbSNP:140756657
3379+c, tdbSNP:201857677
3416+a, gdbSNP:145124653
3430+a, gdbSNP:199889864
3450+c, tdbSNP:142174869
3465+c, tdbSNP:140291609
3471+c, tdbSNP:28363033
3485+c, tdbSNP:17847161
3489+c, tdbSNP:144796715
3507+dbSNP:
3507+c, tdbSNP:187215272
3525+c, tdbSNP:139170126
3548+c, tdbSNP:201043075
3554+c, tdbSNP:200477291
3557+a, gdbSNP:62642507
3563+a, gdbSNP:143985245
3617+a, gdbSNP:140795639
3633+c, tdbSNP:150815590
3636+c, tdbSNP:149733369
3642+c, tdbSNP:201788789
3672+dbSNP:
3672+c, tdbSNP:181541956
3674+c, tdbSNP:201342639
3684+c, tdbSNP:140362296
3762+c, tdbSNP:200225889
3774+dbSNP:
3774+c, tdbSNP:201413380
3776+g, tdbSNP:200660287
3779+a, gdbSNP:199744627
3807+c, tdbSNP:144608803
3894+dbSNP:
3894+c, tdbSNP:180849514
3903+c, tdbSNP:146462580
3918+c, tdbSNP:28363051
3922+a, gdbSNP:140604042
3965+dbSNP:
3965+c, tdbSNP:138539339
3997+c, tdbSNP:147295617
4002+c, tdbSNP:2229626
4029+g, tdbSNP:151034350
4090+c, tdbSNP:140962137
4121+a, tdbSNP:146286346
4133+c, tdbSNP:146476722
4134+c, gdbSNP:2229627
4189+dbSNP:
4189+c, tdbSNP:145465326
4203+c, tdbSNP:145772624
4224+a, gdbSNP:10194657
4231+a, cdbSNP:141474061
4249+c, tdbSNP:201434233
4250+a, gdbSNP:185927605
4264+c, gdbSNP:138212021
4305+dbSNP:
4305+c, tdbSNP:146055277
4309+c, tdbSNP:142633777
4328+a, gdbSNP:28363057
4409+a, gdbSNP:148653106
4419+c, g, tdbSNP:113781401
4431+c, tdbSNP:200701419
4432+a, gdbSNP:147555773
4456+a, cdbSNP:142642168
4457+a, gdbSNP:2229629
4489+a, gdbSNP:143752008
4537+dbSNP:
4537+c, tdbSNP:141874180
4567+a, gdbSNP:28363065
4605+a, cdbSNP:113739268
4626+a, gdbSNP:146041774
4660+c, tdbSNP:188009487
4724+c, tdbSNP:199859726
4934+c, tdbSNP:3732298
4942+g, tdbSNP:943
5022+g, tdbSNP:71418756
5232+g, tdbSNP:3732296
5261+a, tdbSNP:181951107
5349+a, gdbSNP:3821305
5364+c, tdbSNP:113526604
5401+a, gdbSNP:116063235
5439+a, gdbSNP:184525009
5468+a, gdbSNP:3732295
5496..5497+, tdbSNP:3832164
5497..5498+, adbSNP:28363066
5526..5529+, aatgdbSNP:28363067
5579+a, gdbSNP:28384368
5731+c, tdbSNP:189099127
5785+c, tdbSNP:28384369
5792+a, tdbSNP:181865505
6098+c, tdbSNP:34573284
6110+a, gdbSNP:9679561
6129+a, gdbSNP:13429546
6133+a, gdbSNP:189787667
6477+c, tdbSNP:75839794
6481+g, tdbSNP:115223998
6601+c, tdbSNP:28384370
6696+a, gdbSNP:185405321
6772..6773+, tdbSNP:143433977
6787..6788+, t, ttdbSNP:58293122
6822+c, tdbSNP:3202369
6829+g, tdbSNP:189675952
6850+g, tdbSNP:1061314
6856+, aaatdbSNP:28384371
6907+a, tdbSNP:183410868
6959+a, gdbSNP:111313175
6988+a, gdbSNP:139749953
6993+c, tdbSNP:144549243
7019+g, tdbSNP:28384372
7059+a, cdbSNP:186400213
Gene SymbolHK2
Gene SynonymHKII; HXK2
Chromosome2
Locus Map2p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000189 Homo sapiens hexokinase 2 (HK2), mRNA. In-stock $809.00 $760.00 15
Title Mitochondrial localization of TIGAR under hypoxia stimulates HK2 and lowers ROS and cell death .
Author Cheung,E.C., Ludwig,R.L. and Vousden,K.H.
Journal Proc. Natl. Acad. Sci. U.S.A. 109 (50), 20491-20496 (2012)
Title Biologic correlation between glucose transporters, hexokinase-II, Ki-67 and FDG uptake in malignant melanoma .
Author Park,S.G., Lee,J.H., Lee,W.A. and Han,K.M.
Journal Nucl. Med. Biol. 39 (8), 1167-1172 (2012)
Title Overexpression of hexokinase-2 in giant cell tumor of bone is associated with false positive in bone tumor on FDG-PET/CT .
Author Hoshi,M., Takada,J., Oebisu,N., Hata,K., Ieguchi,M. and Nakamura,H.
Journal Arch Orthop Trauma Surg 132 (11), 1561-1568 (2012)
Title MicroRNA-143 (miR-143) regulates cancer glycolysis via targeting hexokinase 2 gene .
Author Fang,R., Xiao,T., Fang,Z., Sun,Y., Li,F., Gao,Y., Feng,Y., Li,L., Wang,Y., Liu,X., Chen,H., Liu,X.Y. and Ji,H.
Journal J. Biol. Chem. 287 (27), 23227-23235 (2012)
Title Choline kinase alpha and hexokinase-2 protein expression in hepatocellular carcinoma: association with survival .
Author Kwee,S.A., Hernandez,B., Chan,O. and Wong,L.
Journal PLoS ONE 7 (10), E46591 (2012)
Title Glucose catabolism in cancer cells. Isolation, sequence, and activity of the promoter for type II hexokinase .
Author Mathupala,S.P., Rempel,A. and Pedersen,P.L.
Journal J. Biol. Chem. 270 (28), 16918-16925 (1995)
Title Identification of four amino acid substitutions in hexokinase II and studies of relationships to NIDDM, glucose effectiveness, and insulin sensitivity .
Author Echwald,S.M., Bjorbaek,C., Hansen,T., Clausen,J.O., Vestergaard,H., Zierath,J.R., Printz,R.L., Granner,D.K. and Pedersen,O.
Journal Diabetes 44 (3), 347-353 (1995)
Title Analysis of the hexokinase II gene in subjects with insulin resistance and NIDDM and detection of a Gln142-->His substitution .
Author Vidal-Puig,A., Printz,R.L., Stratton,I.M., Granner,D.K. and Moller,D.E.
Journal Diabetes 44 (3), 340-346 (1995)
Title Amino acid substitutions in hexokinase II among patients with NIDDM .
Author Laakso,M., Malkki,M. and Deeb,S.S.
Journal Diabetes 44 (3), 330-334 (1995)
Title Steady state transcript levels of the type II hexokinase and type 1 glucose transporter in human tumor cell lines .
Author Shinohara,Y., Yamamoto,K., Kogure,K., Ichihara,J. and Terada,H.
Journal Cancer Lett. 82 (1), 27-32 (1994)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.