• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens hexokinase 2 (HK2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu25460 Homo sapiens hexokinase 2 (HK2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu25460C Homo sapiens hexokinase 2 (HK2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000189.4, 40806188
Length 2754 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens hexokinase 2 (HK2), mRNA.
Product hexokinase-2
Comment

Summary: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes hexokinase 2, the predominant form found in skeletal muscle. It localizes to the outer membrane of mitochondria. Expression of this gene is insulin-responsive, and studies in rat suggest that it is involved in the increased rate of glycolysis seen in rapidly growing cancer cells. [provided by RefSeq, Apr 2009].

RefSeq NP_000180.2
CDS 1927..4680
Misc Feature(1)1783..1785
Misc Feature(2)1927..1962
Misc Feature(3)1927..1962
Misc Feature(4)1960..3306
Misc Feature(5)1963..3351
Misc Feature(6)2167..2712
Misc Feature(7)order(2176..2187,2191..2193,2197..2199,2551..2553,
Misc Feature(8)2176..2190
Misc Feature(9)2389..2394
Misc Feature(10)2440..2445
Misc Feature(11)2548..2553
Misc Feature(12)2593..3306
Misc Feature(13)2797..2808
Misc Feature(14)3163..3171
Misc Feature(15)3310..4650
Misc Feature(16)3352..4677
Misc Feature(17)3511..4023
Misc Feature(18)order(3520..3531,3535..3537,3541..3543,3895..3897,
Misc Feature(19)3520..3534
Misc Feature(20)3733..3738
Misc Feature(21)3784..3789
Misc Feature(22)3892..3897
Misc Feature(23)3937..4650
Misc Feature(24)3970..3975
Misc Feature(25)4141..4152
Misc Feature(26)4507..4515
Exon (1)1..1989
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (2)1990..2152
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (3)2153..2301
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (4)2302..2421
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (5)2422..2517
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (6)2518..2617
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (7)2618..2801
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (8)2802..2957
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (9)2958..3191
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (10)3192..3496
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (11)3497..3645
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (12)3646..3765
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (13)3766..3861
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (14)3862..3961
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (15)3962..4145
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (16)4146..4301
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (17)4302..4535
Gene:HK2
Gene Synonym:HKII; HXK2
Exon (18)4536..7093
Gene:HK2
Gene Synonym:HKII; HXK2
Translation MIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAA VKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMR GSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGV EGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYME EMRHIDMVEGDEGRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGM YMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLG LDPTQEDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKH PHFAKRLHKTVRRLVPGCDVRFLRSEDGSGKGAAMVTAVAYRLADQHRARQKTLEHLQLS HDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRV LLVRVRNGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGF TFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVG TMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEEGRMCVNMEWGAFGDNGCLDD FRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRG IFETKFLSQIESDCLALLQVRAILQHLGLESTCDDSIIVKEVCTVVARRAAQLCGAGMAA VVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFLQSEDGSGKG AALITAVACRIREAGQR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
148+c, gdbSNP:114606216
184+c, tdbSNP:79280243
274+a, gdbSNP:191326320
318+a, gdbSNP:656489
434+g, tdbSNP:138466922
506+a, gdbSNP:28362959
522+a, tdbSNP:371311113
complement(694)-g, adbSNP:11556193
696+a, gdbSNP:6741953
728+c, tdbSNP:367927916
780+c, tdbSNP:141088257
808+c, tdbSNP:372069505
830+a, cdbSNP:375693066
862+a, gdbSNP:372384305
1074+c, tdbSNP:113962612
complement(1089..1090)-, ctdbSNP:3832165
1185+c, tdbSNP:57969488
1214+c, tdbSNP:375339670
complement(1431)-t, adbSNP:3732302
1449+c, gdbSNP:28362960
1451+a, gdbSNP:369722035
1615+, tdbSNP:372458289
1660+c, tdbSNP:368954762
1694+c, gdbSNP:11556194
1905+c, tdbSNP:199694507
1938+a, gdbSNP:150568013
1953+c, tdbSNP:368236146
1978+c, gdbSNP:201636455
1986+c, gdbSNP:371706829
1995+dbSNP:
1995+c, tdbSNP:200787018
1999+c, tdbSNP:376757872
2015+a, gdbSNP:142756990
2050+c, tdbSNP:372666431
2051+a, gdbSNP:375609405
2057+a, gdbSNP:201380686
2097+c, tdbSNP:139553168
2121+c, tdbSNP:369629969
2127..2128+, tdbSNP:35614058
2134+a, tdbSNP:200036720
2179+dbSNP:
2179+c, tdbSNP:377756765
2197+c, tdbSNP:371320494
2220+a, gdbSNP:143863592
2242+a, gdbSNP:142433390
2265+c, tdbSNP:192335098
2352+dbSNP:
2352+a, tdbSNP:2229621
2373+a, tdbSNP:112341087
2378..2379+, gdbSNP:35250889
2391+a, gdbSNP:61755708
2418+c, tdbSNP:149112391
2427+dbSNP:
2427+c, tdbSNP:138918973
2478+c, tdbSNP:369004368
2484+a, gdbSNP:147398307
2494+c, tdbSNP:141663207
2495+a, gdbSNP:139442407
2529+dbSNP:
2529+c, tdbSNP:146408073
2538+c, gdbSNP:28363005
2541..2542+, gggggggggdbSNP:143351537
2543+g, tdbSNP:139726144
2629+dbSNP:
2629+a, gdbSNP:369460914
2660+c, tdbSNP:144438174
2661+c, tdbSNP:373457354
2679+c, tdbSNP:2229622
2716+c, tdbSNP:147035224
2718+c, tdbSNP:375240379
2733+a, gdbSNP:202135697
2740+a, gdbSNP:141419754
2746+c, tdbSNP:28363006
2754+a, gdbSNP:368905567
2777+a, gdbSNP:182426373
2828+dbSNP:
2828+a, gdbSNP:199736350
2835+a, gdbSNP:370773572
2838+a, gdbSNP:28363014
2866+c, gdbSNP:28363015
2888+c, g, tdbSNP:36066402
2892+a, gdbSNP:143931243
complement(2918)-t, cdbSNP:28363016
2919+c, tdbSNP:61751209
complement(2920)-t, cdbSNP:35677390
2952+c, tdbSNP:374980610
2971+dbSNP:
2971+a, gdbSNP:367777975
2974+c, tdbSNP:147658100
2983+c, tdbSNP:61748096
2999+a, gdbSNP:201385411
3006+c, tdbSNP:374770603
3010+a, gdbSNP:371669153
3021+g, tdbSNP:35396457
3030+c, tdbSNP:367936666
3043+c, tdbSNP:199992983
3072+c, tdbSNP:200608341
3084+c, tdbSNP:371844857
3085+g, tdbSNP:28363029
3087+a, gdbSNP:138547217
3100+a, gdbSNP:145270085
3198+dbSNP:
3198+c, gdbSNP:375820063
3202+c, tdbSNP:376768203
3209+a, gdbSNP:368670086
3216+c, tdbSNP:143068594
3220+c, tdbSNP:148796379
3224+a, gdbSNP:368353026
3232+c, tdbSNP:150873116
3240+c, tdbSNP:372380659
3243+c, tdbSNP:17847160
3276+c, tdbSNP:371873156
3318+c, tdbSNP:375412146
3319+c, gdbSNP:113525671
3328+c, tdbSNP:368018473
3329+a, gdbSNP:140756657
3376+c, tdbSNP:376177782
3379+c, tdbSNP:201857677
3416+a, gdbSNP:145124653
3430+a, gdbSNP:199889864
3446+c, tdbSNP:369199775
3450+c, tdbSNP:142174869
3465+c, tdbSNP:140291609
3471+c, tdbSNP:28363033
3485+c, tdbSNP:17847161
3489+c, tdbSNP:144796715
3507+dbSNP:
3507+c, tdbSNP:187215272
3525+c, tdbSNP:139170126
3548+c, tdbSNP:201043075
3554+c, tdbSNP:200477291
3555+c, tdbSNP:267599463
3556+c, tdbSNP:267599464
3557+a, gdbSNP:62642507
3563+a, gdbSNP:143985245
3589+a, tdbSNP:371236382
3597+c, tdbSNP:373048090
3606+c, tdbSNP:369669565
3617+a, gdbSNP:140795639
3633+c, tdbSNP:150815590
3636+c, tdbSNP:149733369
3642+c, tdbSNP:201788789
3659+dbSNP:
3659+c, tdbSNP:375536472
3667+a, tdbSNP:368661495
3672+c, tdbSNP:181541956
3674+c, tdbSNP:201342639
3684+c, tdbSNP:140362296
3691+a, gdbSNP:375206881
3762+c, tdbSNP:200225889
3774+dbSNP:
3774+c, tdbSNP:201413380
3776+g, tdbSNP:200660287
3779+a, gdbSNP:199744627
3805+g, tdbSNP:369111935
3807+c, tdbSNP:144608803
3816+c, tdbSNP:377323846
3857+a, gdbSNP:371330605
3894+dbSNP:
3894+c, tdbSNP:180849514
3903+c, tdbSNP:146462580
3918+c, tdbSNP:28363051
3922+a, gdbSNP:140604042
3954+c, gdbSNP:372338794
3965+dbSNP:
3965+c, tdbSNP:138539339
3985+a, gdbSNP:372422018
3997+c, tdbSNP:147295617
4002+c, tdbSNP:2229626
4029+g, tdbSNP:151034350
4090+c, tdbSNP:140962137
4095+a, gdbSNP:375435608
4121+a, tdbSNP:146286346
4133+c, tdbSNP:146476722
4134+c, gdbSNP:2229627
4149+dbSNP:
4149+c, tdbSNP:368757678
4189+c, tdbSNP:145465326
4203+c, tdbSNP:145772624
4224+a, gdbSNP:10194657
4231+a, cdbSNP:141474061
4249+c, tdbSNP:201434233
4250+a, gdbSNP:185927605
4264+c, gdbSNP:138212021
4305+dbSNP:
4305+c, tdbSNP:146055277
4309+c, tdbSNP:142633777
complement(4328)-g, adbSNP:28363057
4409+a, gdbSNP:148653106
4419+c, g, tdbSNP:113781401
4431+c, tdbSNP:200701419
4432+a, gdbSNP:147555773
4438+a, tdbSNP:377251320
4457+a, gdbSNP:2229629
4483+a, gdbSNP:369758584
4489+a, gdbSNP:143752008
4532+c, tdbSNP:377363473
4537+dbSNP:
4537+c, tdbSNP:141874180
4567+a, gdbSNP:28363065
4605+a, cdbSNP:113739268
4613+a, gdbSNP:370854369
4626+a, gdbSNP:146041774
4654+c, tdbSNP:372862075
4660+c, tdbSNP:188009487
4685+a, cdbSNP:377081632
4724+c, tdbSNP:199859726
4867+c, tdbSNP:371671230
complement(4934)-t, cdbSNP:3732298
4942+g, tdbSNP:943
4962+c, tdbSNP:371245896
5022+g, tdbSNP:71418756
complement(5232)-t, gdbSNP:3732296
5232+g, tdbSNP:41527150
5261+a, tdbSNP:181951107
complement(5349)-g, adbSNP:3821305
5364+c, tdbSNP:113526604
5401+a, gdbSNP:116063235
5439+a, gdbSNP:184525009
complement(5468)-g, adbSNP:3732295
5496..5497+, tdbSNP:3832164
5497..5498+, adbSNP:397786580
5526..5529+, aatgdbSNP:28363067
5530..5531+, aatgdbSNP:386574648
complement(5579)-g, adbSNP:28384368
5653+a, gdbSNP:374615361
5731+c, tdbSNP:189099127
5785+c, tdbSNP:28384369
5792+a, tdbSNP:181865505
6098+c, tdbSNP:34573284
6110+a, gdbSNP:9679561
6129+a, gdbSNP:13429546
6133+a, gdbSNP:189787667
6218..6226+, caaactattdbSNP:370906633
6477+c, tdbSNP:75839794
6481+g, tdbSNP:115223998
6507+g, tdbSNP:372994036
6529+c, tdbSNP:368253167
6601+c, tdbSNP:28384370
6696+a, gdbSNP:185405321
6771..6772+, ttdbSNP:368702364
6772..6773+, t, ttdbSNP:143433977
6787..6788+, t, ttdbSNP:58293122
6810..6811+, gtdbSNP:375672725
complement(6822)-t, cdbSNP:3202369
6829+g, tdbSNP:189675952
complement(6850)-t, gdbSNP:1061314
6850+g, tdbSNP:386514554
6870+c, tdbSNP:372161614
6907+a, tdbSNP:183410868
6959+a, gdbSNP:111313175
6988+a, gdbSNP:139749953
6993+c, tdbSNP:144549243
7019+g, tdbSNP:28384372
7059+a, cdbSNP:186400213
Gene SymbolHK2
Gene SynonymHKII; HXK2
Chromosome2
Locus Map2p13
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000189 Homo sapiens hexokinase 2 (HK2), mRNA. In-stock $99.00 5-7
NM_000189 Homo sapiens hexokinase 2 (HK2), mRNA. In-stock $99.00 5-7
Title Activity of hexokinase is increased by its interaction with hepatitis C virus protein NS5A .
Author Ramiere C, Rodriguez J, Enache LS, Lotteau V, Andre P and Diaz O.
Journal J. Virol. 88 (6), 3246-3254 (2014)
Title Tumor-suppressive microRNA-143/145 cluster targets hexokinase-2 in renal cell carcinoma .
Author Yoshino H, Enokida H, Itesako T, Kojima S, Kinoshita T, Tatarano S, Chiyomaru T, Nakagawa M and Seki N.
Journal Cancer Sci. 104 (12), 1567-1574 (2013)
Title INPP4B-mediated tumor resistance is associated with modulation of glucose metabolism via hexokinase 2 regulation in laryngeal cancer cells .
Author Min JW, Kim KI, Kim HA, Kim EK, Noh WC, Jeon HB, Cho DH, Oh JS, Park IC, Hwang SG and Kim JS.
Journal Biochem. Biophys. Res. Commun. 440 (1), 137-142 (2013)
Title Hexokinase II in breast carcinoma: a potent prognostic factor associated with hypoxia-inducible factor-1alpha and Ki-67 .
Author Sato-Tadano A, Suzuki T, Amari M, Takagi K, Miki Y, Tamaki K, Watanabe M, Ishida T, Sasano H and Ohuchi N.
Journal Cancer Sci. 104 (10), 1380-1388 (2013)
Title Myotonic dystrophy protein kinase (DMPK) prevents ROS-induced cell death by assembling a hexokinase II-Src complex on the mitochondrial surface .
Author Pantic B, Trevisan E, Citta A, Rigobello MP, Marin O, Bernardi P, Salvatori S and Rasola A.
Journal Cell Death Dis 4, E858 (2013)
Title Glucose catabolism in cancer cells. Isolation, sequence, and activity of the promoter for type II hexokinase .
Author Mathupala SP, Rempel A and Pedersen PL.
Journal J. Biol. Chem. 270 (28), 16918-16925 (1995)
Title Identification of four amino acid substitutions in hexokinase II and studies of relationships to NIDDM, glucose effectiveness, and insulin sensitivity .
Author Echwald SM, Bjorbaek C, Hansen T, Clausen JO, Vestergaard H, Zierath JR, Printz RL, Granner DK and Pedersen O.
Journal Diabetes 44 (3), 347-353 (1995)
Title Analysis of the hexokinase II gene in subjects with insulin resistance and NIDDM and detection of a Gln142-->His substitution .
Author Vidal-Puig A, Printz RL, Stratton IM, Granner DK and Moller DE.
Journal Diabetes 44 (3), 340-346 (1995)
Title Amino acid substitutions in hexokinase II among patients with NIDDM .
Author Laakso M, Malkki M and Deeb SS.
Journal Diabetes 44 (3), 330-334 (1995)
Title Steady state transcript levels of the type II hexokinase and type 1 glucose transporter in human tumor cell lines .
Author Shinohara Y, Yamamoto K, Kogure K, Ichihara J and Terada H.
Journal Cancer Lett. 82 (1), 27-32 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.