• THAT   AND
  • THAT   AND


Homo sapiens histatin 3 (HTN3), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_000200 Homo sapiens histatin 3 (HTN3), mRNA. Full Lenth $174.29
ORF Sequence $159.00
RefSeq Version NM_000200.2, 238550171
Length 601 bp
Structure linear
Update Date 12-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens histatin 3 (HTN3), mRNA.
Product histatin-3
Comment

Summary: This gene encodes a member of the histatin family of small, histidine-rich salivary proteins. Histatins exhibit non-immunological, anti-microbial activity in the oral cavity. [provided by RefSeq].

RefSeq NP_000191.1
CDS 118..273
Exon (1)1..104
Exon (2)1..104
Exon (3)105..168
Exon (4)169..189
Exon (5)190..219
Exon (6)220..306
Exon (7)307..578
Translation MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
206+a, gdbSNP:114647960
206+a, gdbSNP:78169960
216+c, tdbSNP:28491522
239+a, gdbSNP:1136511
241+c, gdbSNP:58376281
243+c, tdbSNP:1849937
258+a, tdbSNP:17147990
276+a, tdbSNP:776851
289+c, tdbSNP:1136515
344+c, tdbSNP:75067954
402+a, cdbSNP:73826057
Gene SymbolHTN3
Gene SynonymHIS2; HTN2; HTN5
Chromosome4
Locus Map4q13
All Transcripts NM_000200
Title Salivary histatin 5 internalization by translocation, but not endocytosis, is required for fungicidal activity in Candida albicans .
Author Jang,W.S., Bajwa,J.S., Sun,J.N. and Edgerton,M.
Journal Mol. Microbiol. 77 (2), 354-370 (2010)
Title New genetic associations detected in a host response study to hepatitis B vaccine .
Author Davila,S., Froeling,F.E., Tan,A., Bonnard,C., Boland,G.J., Snippe,H., Hibberd,M.L. and Seielstad,M.
Journal Genes Immun. 11 (3), 232-238 (2010)
Title Polymorphism of salivary histatin gene and periodontal disease in the Japanese population .
Author Fujigaki,Y., Imamura,Y., Oomori,Y., Ouryouji,K., Miyazawa,H. and Wang,P.L.
Journal J Int Acad Periodontol 11 (3), 220-225 (2009)
Title Cooperation of salivary protein histatin 3 with heat shock cognate protein 70 relative to the G1/S transition in human gingival fibroblasts .
Author Imamura,Y., Fujigaki,Y., Oomori,Y., Usui,S. and Wang,P.L.
Journal J. Biol. Chem. 284 (21), 14316-14325 (2009)
Title Histatins are the major wound-closure stimulating factors in human saliva as identified in a cell culture assay .
Author Oudhoff,M.J., Bolscher,J.G., Nazmi,K., Kalay,H., van 't Hof,W., Amerongen,A.V. and Veerman,E.C.
Journal FASEB J. 22 (11), 3805-3812 (2008)
Title Structural relationship between human salivary histatins .
Author Troxler,R.F., Offner,G.D., Xu,T., Vanderspek,J.C. and Oppenheim,F.G.
Journal J. Dent. Res. 69 (1), 2-6 (1990)
Title Rapid purification and characterization of histatins (histidine-rich polypeptides) from human whole saliva .
Author Sugiyama,K., Ogino,T. and Ogata,K.
Journal Arch. Oral Biol. 35 (6), 415-419 (1990)
Title Molecular cloning of human submandibular histatins .
Author vanderSpek,J.C., Offner,G.D., Troxler,R.F. and Oppenheim,F.G.
Journal Arch. Oral Biol. 35 (2), 137-143 (1990)
Title Localization of the genes for histatins to human chromosome 4q13 and tissue distribution of the mRNAs .
Author vanderSpek,J.C., Wyandt,H.E., Skare,J.C., Milunsky,A., Oppenheim,F.G. and Troxler,R.F.
Journal Am. J. Hum. Genet. 45 (3), 381-387 (1989)
Title Histatins, a family of salivary histidine-rich proteins, are encoded by at least two loci (HIS1 and HIS2) .
Author Sabatini,L.M. and Azen,E.A.
Journal Biochem. Biophys. Res. Commun. 160 (2), 495-502 (1989)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878