• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens insulin (INS), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_000207 Homo sapiens insulin (INS), transcript variant 1, mRNA. ORF Sequence $159.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000207.2, 109148525
Length 469 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens insulin (INS), transcript variant 1, mRNA.
Product insulin preproprotein
Comment

Summary: After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010].


Transcript Variant: This transcript (1) represents the shortest variant. Variants 1-3 encode the same protein.

RefSeq NP_000198.1
CDS 60..392
Misc Feature(1)132..134
Misc Feature(2)132..134
Misc Feature(3)135..389
Misc Feature(4)141..143
Misc Feature(5)order(153..155,162..164,168..170,381..383)
Misc Feature(6)156..158
Misc Feature(7)162..164
Misc Feature(8)168..170
Misc Feature(9)168..170
Misc Feature(10)171..173
Misc Feature(11)174..176
Misc Feature(12)177..179
Misc Feature(13)177..179
Misc Feature(14)180..182
Misc Feature(15)192..194
Misc Feature(16)198..200
Misc Feature(17)201..203
Misc Feature(18)201..203
Misc Feature(19)204..206
Misc Feature(20)222..224
Misc Feature(21)324..326
Exon (1)1..42
Gene:INS
Gene Synonym:IDDM2; ILPR; IRDN; MODY10
Exon (2)43..246
Gene:INS
Gene Synonym:IDDM2; ILPR; IRDN; MODY10
Exon (3)247..465
Gene:INS
Gene Synonym:IDDM2; ILPR; IRDN; MODY10
Translation MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(51)-dbSNP:
complement(51)-t, cdbSNP:5505
complement(52)-g, adbSNP:11557611
complement(53)-t, cdbSNP:11557605
complement(75)-t, cdbSNP:121908278
complement(76)-g, adbSNP:121908259
complement(86)-t, cdbSNP:11557610
complement(95)-g, adbSNP:3842744
complement(107)-g, cdbSNP:151134873
complement(122)-g, adbSNP:11564720
complement(126)-g, adbSNP:13306444
complement(130)-t, c, adbSNP:80356663
complement(144)-g, cdbSNP:121908272
complement(153)-g, c, adbSNP:80356664
complement(159)-g, cdbSNP:121918101
complement(163)-t, cdbSNP:121908273
complement(172)-t, cdbSNP:11557614
complement(186)-t, gdbSNP:80356666
complement(188)-g, adbSNP:201392940
complement(196)-g, adbSNP:121908260
complement(199)-t, gdbSNP:80356667
complement(200)-g, adbSNP:11557609
complement(202)-t, g, cdbSNP:80356668
complement(206)-g, adbSNP:148685531
complement(214)-g, cdbSNP:145038693
complement(217)-t, gdbSNP:202244834
complement(222)-t, cdbSNP:121908261
complement(260)-c, adbSNP:41301451
complement(261)-c, adbSNP:121908279
complement(283)-t, cdbSNP:144093133
complement(286)-t, cdbSNP:139264769
complement(309)-g, adbSNP:121908274
complement(324)-t, cdbSNP:80356669
complement(325)-t, g, c, adbSNP:28933985
complement(327)-t, gdbSNP:80356670
complement(333)-t, gdbSNP:121918102
complement(346)-g, c, adbSNP:80356671
complement(361)-g, cdbSNP:121908276
complement(365)-t, cdbSNP:11557607
complement(367)-g, adbSNP:121908277
complement(368)-t, cdbSNP:11557608
complement(372)-t, cdbSNP:11557616
complement(382)-g, adbSNP:80356672
complement(394)-g, adbSNP:200306755
complement(396)-t, cdbSNP:11557606
complement(401)-t, cdbSNP:3842752
complement(414)-c, adbSNP:3842753
complement(419)-g, adbSNP:199866212
complement(435)-t, cdbSNP:192030414
complement(445)-t, cdbSNP:41313495
complement(451..452)-c, adbSNP:11557615
Gene SymbolINS
Gene SynonymIDDM2; ILPR; IRDN; MODY10
Chromosome11
Locus Map11p15.5
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000207 Homo sapiens insulin (INS), transcript variant 1, mRNA. Full Length $159.00
ORF Sequence $159.00
NM_001185097 Homo sapiens insulin (INS), transcript variant 2, mRNA. Full Length $159.00
ORF Sequence $159.00
NM_001185098 Homo sapiens insulin (INS), transcript variant 3, mRNA. Full Length $187.92
ORF Sequence $159.00
Title Selective serotonin reuptake inhibitors (SSRIs) inhibit insulin secretion and action in pancreatic beta cells .
Author Isaac,R., Boura-Halfon,S., Gurevitch,D., Shainskaya,A., Levkovitz,Y. and Zick,Y.
Journal J. Biol. Chem. 288 (8), 5682-5693 (2013)
Title Proinsulin intermolecular interactions during secretory trafficking in pancreatic beta cells .
Author Haataja,L., Snapp,E., Wright,J., Liu,M., Hardy,A.B., Wheeler,M.B., Markwardt,M.L., Rizzo,M. and Arvan,P.
Journal J. Biol. Chem. 288 (3), 1896-1906 (2013)
Title How insulin engages its primary binding site on the insulin receptor .
Author Menting,J.G., Whittaker,J., Margetts,M.B., Whittaker,L.J., Kong,G.K., Smith,B.J., Watson,C.J., Zakova,L., Kletvikova,E., Jiracek,J., Chan,S.J., Steiner,D.F., Dodson,G.G., Brzozowski,A.M., Weiss,M.A., Ward,C.W. and Lawrence,M.C.
Journal Nature 493 (7431), 241-245 (2013)
Title mTORC1 and mTORC2 regulate insulin secretion through Akt in INS-1 cells .
Author Le Bacquer,O., Queniat,G., Gmyr,V., Kerr-Conte,J., Lefebvre,B. and Pattou,F.
Journal J. Endocrinol. 216 (1), 21-29 (2013)
Title [Cloning, primary structure determination and expression of preproinsulin cDNA from human insulinoma in Escherichia coli] .
Author Chekhranova,M.K., Shuvalova,E.R., Kutin,A.M., Butnev,V.Iu., Valentsova,A.B., Il'ina,E.N. and Pankov,Iu.A.
Journal Mol. Biol. (Mosk.) 26 (3), 596-600 (1992)
Title Nucleotide sequence of a cDNA clone encoding human preproinsulin .
Author Bell,G.I., Swain,W.F., Pictet,R., Cordell,B., Goodman,H.M. and Rutter,W.J.
Journal Nature 282 (5738), 525-527 (1979)
Title A structurally abnormal insulin causing human diabetes .
Author Tager,H., Given,B., Baldwin,D., Mako,M., Markese,J., Rubenstein,A., Olefsky,J., Kobayashi,M., Kolterman,O. and Poucher,R.
Journal Nature 281 (5727), 122-125 (1979)
Title Effects of altered thyroid function on galactosyl diacylglycerol metabolism in myelinating rat brain .
Author Flynn,T.J., Deshmukh,D.S. and Pieringer,R.A.
Journal J. Biol. Chem. 252 (16), 5864-5870 (1977)
Title Glucagon regulation of plasma ketone body concentration in human diabetes .
Author Schade,D.S. and Eaton,R.P.
Journal J. Clin. Invest. 56 (5), 1340-1344 (1975)
Title Chemistry of insulin; determination of the structure of insulin opens the way to greater understanding of life processes .
Author SANGER,F.
Journal Science 129 (3359), 1340-1344 (1959)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878