• THAT   AND
  • THAT   AND


Homo sapiens insulin (INS), transcript variant 1, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_000207 Homo sapiens insulin (INS), transcript variant 1, mRNA. Full Lenth $159.00
ORF Sequence $159.00


RefSeq Version NM_000207.2, 109148525
Length 469 bp
Structure linear
Update Date 20-MAR-2011
Organism Homo sapiens (human)
Definition Homo sapiens insulin (INS), transcript variant 1, mRNA.
Product insulin preproprotein
Comment

Summary: After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants. [provided by RefSeq].


Transcript Variant: This transcript (1) represents the shortest variant. Variants 1-3 encode the same protein.

RefSeq NP_000198.1
CDS 60..392
Exon (1)1..42
Exon (2)1..42
Exon (3)43..246
Exon (4)247..465
Translation MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
51+c, tdbSNP:5505
complement(52)-g, adbSNP:11557611
53+c, tdbSNP:11557605
75+c, tdbSNP:121908278
76+a, gdbSNP:121908259
86+c, tdbSNP:11557610
95+a, gdbSNP:3842744
122+a, gdbSNP:11564720
126+a, gdbSNP:13306444
130+a, cdbSNP:80356663
144+c, gdbSNP:121908272
153+a, c, gdbSNP:80356664
159+c, gdbSNP:121918101
163+c, tdbSNP:121908273
172+c, tdbSNP:11557614
186+g, tdbSNP:80356666
196+a, gdbSNP:121908260
199+g, tdbSNP:80356667
complement(200)-g, adbSNP:11557609
202+c, g, tdbSNP:80356668
222+c, tdbSNP:121908261
complement(260)-c, adbSNP:41301451
261+a, cdbSNP:121908279
309+a, gdbSNP:121908274
324+c, tdbSNP:80356669
325+a, c, g, tdbSNP:28933985
327+g, tdbSNP:80356670
333+g, tdbSNP:121918102
346+a, c, gdbSNP:80356671
361+c, gdbSNP:121908276
365+c, tdbSNP:11557607
367+a, gdbSNP:121908277
368+c, tdbSNP:11557608
372+c, tdbSNP:11557616
382+a, gdbSNP:80356672
396+c, tdbSNP:11557606
401+c, tdbSNP:3842752
414+a, cdbSNP:3842753
complement(445)-t, cdbSNP:41313495
complement(451..452)-c, adbSNP:11557615
Gene SymbolINS
Gene SynonymIDDM2; ILPR; IRDN; MODY10
Chromosome11
Locus Map11p15.5
All Transcripts NM_000207 , NM_001185097 , NM_001185098
Title N-terminal segment of proinsulin C-peptide active in insulin interaction/desaggregation .
Author Nerelius,C., Alvelius,G. and Jornvall,H.
Journal Biochem. Biophys. Res. Commun. 403 (3-4), 462-467 (2010)
Title Insulin metabolism in human adipocytes from subcutaneous and visceral depots .
Author Fawcett,J., Sang,H., Permana,P.A., Levy,J.L. and Duckworth,W.C.
Journal Biochem. Biophys. Res. Commun. 402 (4), 762-766 (2010)
Title Clinical and molecular genetics of neonatal diabetes due to mutations in the insulin gene .
Author Stoy,J., Steiner,D.F., Park,S.Y., Ye,H., Philipson,L.H. and Bell,G.I.
Journal Rev Endocr Metab Disord 11 (3), 205-215 (2010)
Title Palmitate and insulin synergistically induce IL-6 expression in human monocytes .
Author Bunn,R.C., Cockrell,G.E., Ou,Y., Thrailkill,K.M., Lumpkin,C.K. Jr. and Fowlkes,J.L.
Journal Cardiovasc Diabetol 9, 73 (2010)
Title [Cloning, primary structure determination and expression of preproinsulin cDNA from human insulinoma in Escherichia coli] .
Author Chekhranova,M.K., Shuvalova,E.R., Kutin,A.M., Butnev,V.Iu., Valentsova,A.B., Il'ina,E.N. and Pankov,Iu.A.
Journal Mol. Biol. (Mosk.) 26 (3), 596-600 (1992)
Title Nucleotide sequence of a cDNA clone encoding human preproinsulin .
Author Bell,G.I., Swain,W.F., Pictet,R., Cordell,B., Goodman,H.M. and Rutter,W.J.
Journal Nature 282 (5738), 525-527 (1979)
Title A structurally abnormal insulin causing human diabetes .
Author Tager,H., Given,B., Baldwin,D., Mako,M., Markese,J., Rubenstein,A., Olefsky,J., Kobayashi,M., Kolterman,O. and Poucher,R.
Journal Nature 281 (5727), 122-125 (1979)
Title Effects of altered thyroid function on galactosyl diacylglycerol metabolism in myelinating rat brain .
Author Flynn,T.J., Deshmukh,D.S. and Pieringer,R.A.
Journal J. Biol. Chem. 252 (16), 5864-5870 (1977)
Title Glucagon regulation of plasma ketone body concentration in human diabetes .
Author Schade,D.S. and Eaton,R.P.
Journal J. Clin. Invest. 56 (5), 1340-1344 (1975)
Title Chemistry of insulin; determination of the structure of insulin opens the way to greater understanding of life processes .
Author SANGER,F.
Journal Science 129 (3359), 1340-1344 (1959)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878