• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens insulin (INS), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000207 Homo sapiens insulin (INS), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $248.00 $199.00 10

*Business Day

Related Services

RefSeq Version NM_000207.2, 109148525
Length 469 bp
Structure linear
Update Date 18-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens insulin (INS), transcript variant 1, mRNA.
Product insulin preproprotein
Comment

Summary: After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010].


Transcript Variant: This variant (1) represents the shortest variant. All variants encode the same protein.

RefSeq NP_000198.1
CDS 60..392
Misc Feature(1)132..134
Misc Feature(2)132..134
Misc Feature(3)135..389
Misc Feature(4)141..143
Misc Feature(5)order(153..155,162..164,168..170,381..383)
Misc Feature(6)156..158
Misc Feature(7)162..164
Misc Feature(8)168..170
Misc Feature(9)168..170
Misc Feature(10)171..173
Misc Feature(11)174..176
Misc Feature(12)177..179
Misc Feature(13)177..179
Misc Feature(14)180..182
Misc Feature(15)192..194
Misc Feature(16)198..200
Misc Feature(17)201..203
Misc Feature(18)201..203
Misc Feature(19)204..206
Misc Feature(20)222..224
Misc Feature(21)324..326
Exon (1)1..42
Gene:INS
Gene Synonym:IDDM1; IDDM2; ILPR; IRDN; MODY10
Exon (2)43..246
Gene:INS
Gene Synonym:IDDM1; IDDM2; ILPR; IRDN; MODY10
Exon (3)247..465
Gene:INS
Gene Synonym:IDDM1; IDDM2; ILPR; IRDN; MODY10
Translation MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(52)-dbSNP:
complement(52)-g, adbSNP:11557611
53+c, tdbSNP:11557605
62+a, g, tdbSNP:397515521
75+c, tdbSNP:121908278
76+a, gdbSNP:121908259
complement(84)-g, adbSNP:372122432
86+c, tdbSNP:11557610
95+a, gdbSNP:3842744
complement(107)-g, cdbSNP:151134873
complement(121)-g, adbSNP:369743665
122+a, gdbSNP:11564720
complement(125)-g, adbSNP:375371953
126+a, gdbSNP:13306444
130+a, c, tdbSNP:80356663
144+c, gdbSNP:121908272
153+a, c, gdbSNP:80356664
159+c, gdbSNP:121918101
163+c, tdbSNP:121908273
172+c, tdbSNP:11557614
complement(172)-g, adbSNP:386519278
186+g, tdbSNP:80356666
complement(188)-g, adbSNP:201392940
complement(191)-t, cdbSNP:267602820
196+a, gdbSNP:121908260
199+g, tdbSNP:80356667
200+a, gdbSNP:11557609
202+c, g, tdbSNP:80356668
complement(206)-g, adbSNP:148685531
complement(214)-g, cdbSNP:145038693
complement(216)-t, cdbSNP:368338862
complement(217)-t, gdbSNP:202244834
222+c, tdbSNP:121908261
complement(260)-c, adbSNP:41301451
261+a, cdbSNP:121908279
complement(283)-t, cdbSNP:144093133
complement(286)-t, cdbSNP:139264769
309+a, gdbSNP:121908274
324+c, tdbSNP:80356669
complement(325)-t, cdbSNP:386576621
327+g, tdbSNP:80356670
333+g, tdbSNP:121918102
346+a, c, gdbSNP:80356671
361+c, gdbSNP:121908276
complement(365)-t, cdbSNP:386519276
365+c, tdbSNP:11557607
367+a, gdbSNP:121908277
complement(368)-t, cdbSNP:386519277
368+c, tdbSNP:11557608
complement(372)-t, cdbSNP:386519279
372+c, tdbSNP:11557616
382+a, gdbSNP:80356672
complement(394)-g, adbSNP:200306755
complement(396)-t, cdbSNP:386519275
396+c, tdbSNP:11557606
complement(401)-t, cdbSNP:386587433
401+c, tdbSNP:3842752
complement(402)-t, cdbSNP:370330362
414+a, cdbSNP:3842753
complement(417)-g, adbSNP:369040062
complement(419)-g, adbSNP:199866212
complement(434)-g, adbSNP:376867722
complement(435)-t, cdbSNP:192030414
complement(445)-t, cdbSNP:41313495
complement(451..452)-c, adbSNP:11557615
451+a, gdbSNP:397515519
Gene SymbolINS
Gene SynonymIDDM1; IDDM2; ILPR; IRDN; MODY10
Chromosome11
Locus Map11p15.5
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001185098 Homo sapiens insulin (INS), transcript variant 3, mRNA. In-stock $248.00 $199.00 10
NM_001291897 Homo sapiens insulin (INS), transcript variant 4, mRNA. On-demand $299.00 14
NM_000207 Homo sapiens insulin (INS), transcript variant 1, mRNA. In-stock $248.00 $199.00 10
NM_001185097 Homo sapiens insulin (INS), transcript variant 2, mRNA. In-stock $248.00 $199.00 10
Title Insulin regulates the novel adipokine adipolin/CTRP12: in vivo and ex vivo effects .
Author Tan BK, Lewandowski KC, O'Hare JP and Randeva HS.
Journal J. Endocrinol. 221 (1), 111-119 (2014)
Title Thermodynamics of formation of the insulin hexamer: metal-stabilized proton-coupled assembly of quaternary structure .
Author Carpenter MC and Wilcox DE.
Journal Biochemistry 53 (8), 1296-1301 (2014)
Title [The proinsulin level in the blood of children with type 1 diabetes mellitus of various duration] .
Author Lotosh,N.Iu., Selishcheva,A.A., Nadorov,S.A., Badyshtov,B.A., Volkov,I.E. and Savel'ev,S.V.
Journal Biomed Khim 59 (5), 563-569 (2013)
Title Allele-specific recognition of the 3' splice site of INS intron 1 .
Author Kralovicova J and Vorechovsky I.
Journal Hum. Genet. 128 (4), 383-400 (2010)
Title Global haplotype diversity in the human insulin gene region .
Author Stead JD, Hurles ME and Jeffreys AJ.
Journal Genome Res. 13 (9), 2101-2111 (2003)
Title Permanent Neonatal Diabetes Mellitus .
Author De Leon,D.D. and Stanley,C.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Nucleotide sequence of a cDNA clone encoding human preproinsulin .
Author Bell,G.I., Swain,W.F., Pictet,R., Cordell,B., Goodman,H.M. and Rutter,W.J.
Journal Nature 282 (5738), 525-527 (1979)
Title A structurally abnormal insulin causing human diabetes .
Author Tager,H., Given,B., Baldwin,D., Mako,M., Markese,J., Rubenstein,A., Olefsky,J., Kobayashi,M., Kolterman,O. and Poucher,R.
Journal Nature 281 (5727), 122-125 (1979)
Title Effects of altered thyroid function on galactosyl diacylglycerol metabolism in myelinating rat brain .
Author Flynn,T.J., Deshmukh,D.S. and Pieringer,R.A.
Journal J. Biol. Chem. 252 (16), 5864-5870 (1977)
Title Chemistry of insulin; determination of the structure of insulin opens the way to greater understanding of life processes .
Author SANGER,F.
Journal Science 129 (3359), 1340-1344 (1959)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.