• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19441 Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu19441C Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000209.3, 189095257
Length 852 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA.
Product pancreas/duodenum homeobox protein 1
Comment

Summary: The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_000200.1
CDS 109..960
Misc Feature(1)145..327
Misc Feature(2)145..327
Misc Feature(3)460..477
Misc Feature(4)547..723
Misc Feature(5)order(547..561,565..567,616..618,634..636,673..675,
Misc Feature(6)order(553..555,562..564,682..684,691..696,703..705)
Misc Feature(7)697..717
Misc Feature(8)910..912
Exon (1)1..514
Gene:PDX1
Gene Synonym:GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1
Exon (2)515..2573
Gene:PDX1
Gene Synonym:GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1
Translation MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQG SPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA VMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+, tdbSNP:201066590
23+g, tdbSNP:188482874
86..87+, ctcccggdbSNP:193922352
91+c, tdbSNP:193922351
114+c, tdbSNP:146936598
160+c, tdbSNP:137852785
205+a, cdbSNP:192902098
270+a, gdbSNP:28509441
284+a, tdbSNP:137852784
296+, cdbSNP:193929377
324+c, tdbSNP:193922353
334+a, gdbSNP:137852783
392+a, cdbSNP:375009107
426+g, tdbSNP:193922354
429+a, cdbSNP:201701313
444+c, gdbSNP:149275902
526+dbSNP:
526+a, gdbSNP:143517122
537+c, gdbSNP:148001995
550+c, gdbSNP:193922355
600+g, tdbSNP:80356661
640+a, gdbSNP:80356662
641+a, gdbSNP:387906777
645+a, gdbSNP:200760158
651+c, tdbSNP:75498935
653+c, tdbSNP:369507870
662+g, tdbSNP:202159230
679+a, cdbSNP:193922356
698+a, gdbSNP:137852786
767+a, tdbSNP:201343646
769+a, gdbSNP:150559931
772+a, gdbSNP:368507502
778+a, gdbSNP:137852787
787+c, tdbSNP:372765489
801+c, tdbSNP:200411304
802+a, gdbSNP:367625089
805+g, tdbSNP:371525768
824+a, cdbSNP:199644078
833+c, tdbSNP:193922358
834..835+, ccgdbSNP:193922357
836..837+, gccdbSNP:193922359
865+c, tdbSNP:370787126
881+a, gdbSNP:193922360
1028+a, gdbSNP:374397203
1048+c, tdbSNP:17847223
1177+, adbSNP:55957037
1243..1244+, ggggg, gggggggggdbSNP:141044960
1523..1524+, tctdbSNP:200414219
1532+, cdbSNP:372179991
1602..1603+, tctdbSNP:113506161
1608..1610+, tccdbSNP:201597488
1703..1732+, tccccctcctctccctcctcctcttcttctdbSNP:373152010
1703+a, tdbSNP:71433245
1706..1714+, ccctcctctdbSNP:139276646
1724..1726+, tctdbSNP:201227980
1741+c, tdbSNP:11617235
1747..1748+ctcctcttcttctc, ttdbSNP:386769404
1754+c, tdbSNP:143062765
1796+g, tdbSNP:11617238
1804+c, tdbSNP:190800391
1805+a, gdbSNP:374204593
1811+c, tdbSNP:11617239
1812..1814+, tccdbSNP:71993976
1814..1816+, ctcdbSNP:60008665
1817+c, tdbSNP:11620272
1822..1823+, ttcttctccctcctcttcctcctcdbSNP:371209265
1823+c, tdbSNP:74799049
1831+c, tdbSNP:78382412
1833+c, tdbSNP:11620280
1839+a, tdbSNP:147791430
1841+c, tdbSNP:12560601
1863+a, tdbSNP:9554205
1975+c, tdbSNP:112637982
1982+a, tdbSNP:112525679
1993+a, tdbSNP:74905790
2000+c, tdbSNP:75697516
2084+a, gdbSNP:7981781
2180+c, tdbSNP:112431822
2198+a, gdbSNP:113931775
2198+c, tdbSNP:386442384
2302+a, g, tdbSNP:9319402
2315+c, gdbSNP:113776422
2395+a, gdbSNP:183052606
2417+a, gdbSNP:112640306
2448+a, cdbSNP:187952798
2469+g, tdbSNP:75445448
2560+c, tdbSNP:112632160
2562..2563+, tgtttdbSNP:372475223
Gene SymbolPDX1
Gene SynonymGSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1
Chromosome13
Locus Map13q12.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000209 Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA. On-demand TBD TBD
Title Identification of low-frequency and rare sequence variants associated with elevated or reduced risk of type 2 diabetes .
Author Steinthorsdottir V, Thorleifsson G, Sulem P, Helgason H, Grarup N, Sigurdsson A, Helgadottir HT, Johannsdottir H, Magnusson OT, Gudjonsson SA, Justesen JM, Harder MN, Jorgensen ME, Christensen C, Brandslund I, Sandbaek A, Lauritzen T, Vestergaard H, Linneberg A, Jorgensen T, Hansen T, Daneshpour MS, Fallah MS, Hreidarsson AB, Sigurdsson G, Azizi F, Benediktsson R, Masson G, Helgason A, Kong A, Gudbjartsson DF, Pedersen O, Thorsteinsdottir U and Stefansson K.
Journal Nat. Genet. 46 (3), 294-298 (2014)
Title Coxsackievirus B4 can infect human pancreas ductal cells and persist in ductal-like cell cultures which results in inhibition of Pdx1 expression and disturbed formation of islet-like cell aggregates .
Author Sane F, Caloone D, Gmyr V, Engelmann I, Belaich S, Kerr-Conte J, Pattou F, Desailloud R and Hober D.
Journal Cell. Mol. Life Sci. 70 (21), 4169-4180 (2013)
Title Thermodynamic and structural determinants of differential Pdx1 binding to elements from the insulin and IAPP promoters .
Author Bastidas M and Showalter SA.
Journal J. Mol. Biol. 425 (18), 3360-3377 (2013)
Title Per-Arnt-Sim kinase regulates pancreatic duodenal homeobox-1 protein stability via phosphorylation of glycogen synthase kinase 3beta in pancreatic beta-cells .
Author Semache M, Zarrouki B, Fontes G, Fogarty S, Kikani C, Chawki MB, Rutter J and Poitout V.
Journal J. Biol. Chem. 288 (34), 24825-24833 (2013)
Title Binding polymorphism in the DNA bound state of the Pdx1 homeodomain .
Author Babin V, Wang D, Rose RB and Sagui C.
Journal PLoS Comput. Biol. 9 (8), E1003160 (2013)
Title Transcriptional activation of the GLUT2 gene by the IPF-1/STF-1/IDX-1 homeobox factor .
Author Waeber G, Thompson N, Nicod P and Bonny C.
Journal Mol. Endocrinol. 10 (11), 1327-1334 (1996)
Title Isolation, characterization, and chromosomal mapping of the human insulin promoter factor 1 (IPF-1) gene .
Author Inoue H, Riggs AC, Tanizawa Y, Ueda K, Kuwano A, Liu L, Donis-Keller H and Permutt MA.
Journal Diabetes 45 (6), 789-794 (1996)
Title Localization of human homeodomain transcription factor insulin promoter factor 1 (IPF1) to chromosome band 13q12.1 .
Author Stoffel M, Stein R, Wright CV, Espinosa R 3rd, Le Beau MM and Bell GI.
Journal Genomics 28 (1), 125-126 (1995)
Title Characterization of somatostatin transactivating factor-1, a novel homeobox factor that stimulates somatostatin expression in pancreatic islet cells .
Author Leonard J, Peers B, Johnson T, Ferreri K, Lee S and Montminy MR.
Journal Mol. Endocrinol. 7 (10), 1275-1283 (1993)
Title Permanent Neonatal Diabetes Mellitus .
Author De Leon,D.D. and Stanley,C.A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.