• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000209 Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA. GenEZ ORF Cloning On-demand $TBD TBD

*Business Day

Related Services

RefSeq Version NM_000209.3, 189095257
Length 2573 bp
Structure linear
Update Date 13-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA.
Product pancreas/duodenum homeobox protein 1
Comment

Summary: The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_000200.1
CDS 109..960
Misc Feature(1)145..327
Misc Feature(2)145..327
Misc Feature(3)460..477
Misc Feature(4)547..723
Misc Feature(5)order(547..561,565..567,616..618,634..636,673..675,
Misc Feature(6)order(553..555,562..564,682..684,691..696,703..705)
Misc Feature(7)697..717
Misc Feature(8)910..912
Exon (1)1..514
Gene:PDX1
Gene Synonym:GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1
Exon (2)515..2573
Gene:PDX1
Gene Synonym:GSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1
Translation MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQG SPPDISPYEVPPLADDPAVAHLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELA VMLNLTERHIKIWFQNRRMKWKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQEPR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
4+dbSNP:
4+, tdbSNP:201066590
23+g, tdbSNP:188482874
86..87+, ctcccggdbSNP:193922352
91+c, tdbSNP:193922351
114+c, tdbSNP:146936598
160+c, tdbSNP:137852785
205+a, cdbSNP:192902098
270+a, gdbSNP:28509441
284+a, tdbSNP:137852784
296+, cdbSNP:193929377
324+c, tdbSNP:193922353
334+a, gdbSNP:137852783
426+g, tdbSNP:193922354
429+a, cdbSNP:201701313
444+c, gdbSNP:149275902
526+dbSNP:
526+a, gdbSNP:143517122
537+c, gdbSNP:148001995
550+c, gdbSNP:193922355
600+g, tdbSNP:80356661
640+a, gdbSNP:80356662
645+a, gdbSNP:200760158
651+c, tdbSNP:75498935
662+g, tdbSNP:202159230
679+a, cdbSNP:193922356
698+a, gdbSNP:137852786
767+a, tdbSNP:201343646
769+a, gdbSNP:150559931
778+a, gdbSNP:137852787
801+c, tdbSNP:200411304
824+a, cdbSNP:199644078
833+c, tdbSNP:193922358
834..835+, ccgdbSNP:193922357
836..837+, gccdbSNP:193922359
881+a, gdbSNP:193922360
1048+c, tdbSNP:17847223
1173+, adbSNP:55957037
1243..1244+, ggggg, gggggggggdbSNP:141044960
1523..1524+, tctdbSNP:200414219
1602..1603+, tctdbSNP:113506161
1608..1610+, tccdbSNP:201597488
1703+a, tdbSNP:71433245
1706..1714+, ccctcctctdbSNP:139276646
1724..1726+, tctdbSNP:201227980
1741+c, tdbSNP:11617235
1754+c, tdbSNP:143062765
1796+g, tdbSNP:11617238
1804+c, tdbSNP:190800391
1811+c, tdbSNP:11617239
1812..1814+, tccdbSNP:71993976
1814+, ctcdbSNP:60008665
1817+c, tdbSNP:11620272
1823+c, tdbSNP:74799049
1831+c, tdbSNP:78382412
1833+c, tdbSNP:11620280
1839+a, tdbSNP:147791430
1841+c, tdbSNP:12560601
1863+a, tdbSNP:9554205
1975+c, tdbSNP:112637982
1982+a, tdbSNP:112525679
1993+a, tdbSNP:74905790
2000+c, tdbSNP:75697516
2084+a, gdbSNP:7981781
2180+c, tdbSNP:112431822
2198+a, gdbSNP:113931775
2302+a, g, tdbSNP:9319402
2315+c, gdbSNP:113776422
2395+a, gdbSNP:183052606
2417+a, gdbSNP:112640306
2448+a, cdbSNP:187952798
2469+g, tdbSNP:75445448
2560+c, tdbSNP:112632160
Gene SymbolPDX1
Gene SynonymGSF; IDX-1; IPF1; IUF1; MODY4; PDX-1; STF-1
Chromosome13
Locus Map13q12.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000209 Homo sapiens pancreatic and duodenal homeobox 1 (PDX1), mRNA. On-demand TBD TBD
Title Bile duct expression of pancreatic and duodenal homeobox 1 in perihilar cholangiocarcinogenesis .
Author Igarashi,S., Matsubara,T., Harada,K., Ikeda,H., Sato,Y., Sasaki,M., Matsui,O. and Nakanuma,Y.
Journal Histopathology 61 (2), 266-276 (2012)
Title PDX1 regulation of FABP1 and novel target genes in human intestinal epithelial Caco-2 cells .
Author Chen,C., Fang,R., Chou,L.C., Lowe,A.W. and Sibley,E.
Journal Biochem. Biophys. Res. Commun. 423 (1), 183-187 (2012)
Title A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance .
Author Manning,A.K., Hivert,M.F., Scott,R.A., Grimsby,J.L., Bouatia-Naji,N., Chen,H., Rybin,D., Liu,C.T., Bielak,L.F., Prokopenko,I., Amin,N., Barnes,D., Cadby,G., Hottenga,J.J., Ingelsson,E., Jackson,A.U., Johnson,T., Kanoni,S., Ladenvall,C., Lagou,V., Lahti,J., Lecoeur,C., Liu,Y., Martinez-Larrad,M.T., Montasser,M.E., Navarro,P., Perry,J.R., Rasmussen-Torvik,L.J., Salo,P., Sattar,N., Shungin,D., Strawbridge,R.J., Tanaka,T., van Duijn,C.M., An,P., de Andrade,M., Andrews,J.S., Aspelund,T., Atalay,M., Aulchenko,Y., Balkau,B., Bandinelli,S., Beckmann,J.S., Beilby,J.P., Bellis,C., Bergman,R.N., Blangero,J., Boban,M., Boehnke,M., Boerwinkle,E., Bonnycastle,L.L., Boomsma,D.I., Borecki,I.B., Bottcher,Y., Bouchard,C., Brunner,E., Budimir,D., Campbell,H., Carlson,O., Chines,P.S., Clarke,R., Collins,F.S., Corbaton-Anchuelo,A., Couper,D., de Faire,U., Dedoussis,G.V., Deloukas,P., Dimitriou,M., Egan,J.M., Eiriksdottir,G., Erdos,M.R., Eriksson,J.G., Eury,E., Ferrucci,L., Ford,I., Forouhi,N.G., Fox,C.S., Franzosi,M.G., Franks,P.W., Frayling,T.M., Froguel,P., Galan,P., de Geus,E., Gigante,B., Glazer,N.L., Goel,A., Groop,L., Gudnason,V., Hallmans,G., Hamsten,A., Hansson,O., Harris,T.B., Hayward,C., Heath,S., Hercberg,S., Hicks,A.A., Hingorani,A., Hofman,A., Hui,J., Hung,J., Jarvelin,M.R., Jhun,M.A., Johnson,P.C., Jukema,J.W., Jula,A., Kao,W.H., Kaprio,J., Kardia,S.L., Keinanen-Kiukaanniemi,S., Kivimaki,M., Kolcic,I., Kovacs,P., Kumari,M., Kuusisto,J., Kyvik,K.O., Laakso,M., Lakka,T., Lannfelt,L., Lathrop,G.M., Launer,L.J., Leander,K., Li,G., Lind,L., Lindstrom,J., Lobbens,S., Loos,R.J., Luan,J., Lyssenko,V., Magi,R., Magnusson,P.K., Marmot,M., Meneton,P., Mohlke,K.L., Mooser,V., Morken,M.A., Miljkovic,I., Narisu,N., O'Connell,J., Ong,K.K., Oostra,B.A., Palmer,L.J., Palotie,A., Pankow,J.S., Peden,J.F., Pedersen,N.L., Pehlic,M., Peltonen,L., Penninx,B., Pericic,M., Perola,M., Perusse,L., Peyser,P.A., Polasek,O., Pramstaller,P.P., Province,M.A., Raikkonen,K., Rauramaa,R., Rehnberg,E., Rice,K., Rotter,J.I., Rudan,I., Ruokonen,A., Saaristo,T., Sabater-Lleal,M., Salomaa,V., Savage,D.B., Saxena,R., Schwarz,P., Seedorf,U., Sennblad,B., Serrano-Rios,M., Shuldiner,A.R., Sijbrands,E.J., Siscovick,D.S., Smit,J.H., Small,K.S., Smith,N.L., Smith,A.V., Stancakova,A., Stirrups,K., Stumvoll,M., Sun,Y.V., Swift,A.J., Tonjes,A., Tuomilehto,J., Trompet,S., Uitterlinden,A.G., Uusitupa,M., Vikstrom,M., Vitart,V., Vohl,M.C., Voight,B.F., Vollenweider,P., Waeber,G., Waterworth,D.M., Watkins,H., Wheeler,E., Widen,E., Wild,S.H., Willems,S.M., Willemsen,G., Wilson,J.F., Witteman,J.C., Wright,A.F., Yaghootkar,H., Zelenika,D., Zemunik,T., Zgaga,L., Wareham,N.J., McCarthy,M.I., Barroso,I., Watanabe,R.M., Florez,J.C., Dupuis,J., Meigs,J.B. and Langenberg,C.
Journal Nat. Genet. 44 (6), 659-669 (2012)
Title PDX-1 is a therapeutic target for pancreatic cancer, insulinoma and islet neoplasia using a novel RNA interference platform .
Author Liu,S.H., Rao,D.D., Nemunaitis,J., Senzer,N., Zhou,G., Dawson,D., Gingras,M.C., Wang,Z., Gibbs,R., Norman,M., Templeton,N.S., Demayo,F.J., O'Malley,B., Sanchez,R., Fisher,W.E. and Brunicardi,F.C.
Journal PLoS ONE 7 (8), E40452 (2012)
Title Combined transfection of the three transcriptional factors, PDX-1, NeuroD1, and MafA, causes differentiation of bone marrow mesenchymal stem cells into insulin-producing cells .
Author Guo,Q.S., Zhu,M.Y., Wang,L., Fan,X.J., Lu,Y.H., Wang,Z.W., Zhu,S.J., Wang,Y. and Huang,Y.
Journal Exp Diabetes Res 2012, 672013 (2012)
Title Involvement of the homeodomain-containing transcription factor PDX-1 in islet amyloid polypeptide gene transcription .
Author Watada,H., Kajimoto,Y., Kaneto,H., Matsuoka,T., Fujitani,Y., Miyazaki,Ji. and Yamasaki,Y.
Journal Biochem. Biophys. Res. Commun. 229 (3), 746-751 (1996)
Title Transcriptional activation of the GLUT2 gene by the IPF-1/STF-1/IDX-1 homeobox factor .
Author Waeber,G., Thompson,N., Nicod,P. and Bonny,C.
Journal Mol. Endocrinol. 10 (11), 1327-1334 (1996)
Title Isolation, characterization, and chromosomal mapping of the human insulin promoter factor 1 (IPF-1) gene .
Author Inoue,H., Riggs,A.C., Tanizawa,Y., Ueda,K., Kuwano,A., Liu,L., Donis-Keller,H. and Permutt,M.A.
Journal Diabetes 45 (6), 789-794 (1996)
Title Localization of human homeodomain transcription factor insulin promoter factor 1 (IPF1) to chromosome band 13q12.1 .
Author Stoffel,M., Stein,R., Wright,C.V., Espinosa,R. III, Le Beau,M.M. and Bell,G.I.
Journal Genomics 28 (1), 125-126 (1995)
Title Characterization of somatostatin transactivating factor-1, a novel homeobox factor that stimulates somatostatin expression in pancreatic islet cells .
Author Leonard,J., Peers,B., Johnson,T., Ferreri,K., Lee,S. and Montminy,M.R.
Journal Mol. Endocrinol. 7 (10), 1275-1283 (1993)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.