• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000222 Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT), transcript variant 1, mRNA. GenEZ ORF Cloning In-stock $809.00 $760.00 15

*Business Day

Related Services

RefSeq Version NM_000222.2, 148005048
Length 5190 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT), transcript variant 1, mRNA.
Product mast/stem cell growth factor receptor Kit isoform 1 precursor
Comment

Summary: This gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).

RefSeq NP_000213.1
CDS 88..3018
Misc Feature(1)1
Misc Feature(2)1
Misc Feature(3)26
Misc Feature(4)30
Misc Feature(5)217..420
Misc Feature(6)745..1008
Misc Feature(7)775..999
Misc Feature(8)1018..1320
Misc Feature(9)order(1225..1236,1243..1245)
Misc Feature(10)1363..1602
Misc Feature(11)1660..1722
Misc Feature(12)1720..1722
Misc Feature(13)1726..1728
Misc Feature(14)1744..2871
Misc Feature(15)1744..1746
Misc Feature(16)1789..1797
Misc Feature(17)1789..1791
Misc Feature(18)1789..1791
Misc Feature(19)1795..1797
Misc Feature(20)1795..1797
Misc Feature(21)1795..1797
Misc Feature(22)1852..2859
Misc Feature(23)order(1870..1890,1894..1896,1948..1950,1954..1956,
Misc Feature(24)order(1870..1875,1879..1890,1894..1896,1948..1950,
Misc Feature(25)2194..2196
Misc Feature(26)2194..2196
Misc Feature(27)2248..2250
Misc Feature(28)2248..2250
Misc Feature(29)2275..2277
Misc Feature(30)2308..2310
Misc Feature(31)2308..2310
Misc Feature(32)2323..2325
Misc Feature(33)2323..2325
Misc Feature(34)2326..2328
Misc Feature(35)order(2461..2463,2473..2475,2569..2583,2608..2610,
Misc Feature(36)2512..2589
Misc Feature(37)2548..2550
Misc Feature(38)2548..2550
Misc Feature(39)2554..2556
Misc Feature(40)2758..2760
Misc Feature(41)2785..2787
Misc Feature(42)2785..2787
Misc Feature(43)2893..2895
Misc Feature(44)2893..2895
Misc Feature(45)2893..2895
Misc Feature(46)2962..2964
Misc Feature(47)2962..2964
Exon (1)1..154
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (2)155..424
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (3)425..706
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (4)707..843
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (5)844..1012
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (6)1013..1202
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (7)1203..1318
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (8)1319..1433
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (9)1434..1627
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (10)1628..1734
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (11)1735..1861
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (12)1862..1966
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (13)1967..2077
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (14)2078..2228
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (15)2229..2320
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (16)2321..2448
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (17)2449..2571
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (18)2572..2683
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (19)2684..2783
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (20)2784..2889
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Exon (21)2890..5176
Gene:KIT
Gene Synonym:C-Kit; CD117; PBT; SCFR
Translation MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV GSTASSSQPLLVHDDV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
51+c, tdbSNP:199508856
60+a, gdbSNP:368987793
67+g, tdbSNP:201778132
74+a, tdbSNP:140909964
83+c, tdbSNP:202070769
139+c, tdbSNP:370787811
188+dbSNP:
188+c, tdbSNP:55755457
206+a, gdbSNP:373374682
210+a, tdbSNP:72549300
233+a, gdbSNP:376469897
234+a, cdbSNP:72549301
235+g, tdbSNP:200950545
240+c, tdbSNP:147363921
241+a, gdbSNP:121913505
282+a, gdbSNP:200121443
286+a, tdbSNP:139441923
287+c, gdbSNP:144933028
308+c, tdbSNP:147943899
317+a, gdbSNP:371353189
338+c, tdbSNP:201872586
339+g, tdbSNP:56411694
363+c, tdbSNP:373066995
367+a, gdbSNP:146081659
375+a, gdbSNP:150026676
390+c, tdbSNP:145333060
436+dbSNP:
436+a, cdbSNP:189660852
454..455+, cdbSNP:35525445
455+c, tdbSNP:371303702
483+a, gdbSNP:149172424
541+c, gdbSNP:145053429
551+c, tdbSNP:367719489
571+g, tdbSNP:201222895
589+a, gdbSNP:200851152
590+c, tdbSNP:149092990
591+a, gdbSNP:140469176
609+c, tdbSNP:145993517
619+a, gdbSNP:115585711
678+a, gdbSNP:140839561
742+dbSNP:
742+c, gdbSNP:141679490
783+a, gdbSNP:201988161
794+a, cdbSNP:374957554
822+a, gdbSNP:150150449
863+dbSNP:
863+a, gdbSNP:200422460
908+c, tdbSNP:138585275
926+c, tdbSNP:386833402
927+c, gdbSNP:142772432
929+a, gdbSNP:147367441
965+a, gdbSNP:137909416
997+a, gdbSNP:202052259
1031+dbSNP:
1031+a, tdbSNP:377590954
1039+a, gdbSNP:143388949
1044+a, gdbSNP:377102206
1051+a, gdbSNP:147540142
1065+c, tdbSNP:148594615
1143+c, gdbSNP:372759291
1178+a, gdbSNP:375734891
1182+a, tdbSNP:142963781
1206+dbSNP:
1206+c, tdbSNP:72549293
1207+a, gdbSNP:73137716
1222+a, cdbSNP:376275305
1242+c, gdbSNP:373472667
1281+c, tdbSNP:376940990
1282+a, gdbSNP:143707288
1286+a, gdbSNP:72549294
1315+a, cdbSNP:111646246
1317+c, tdbSNP:140536677
1368+dbSNP:
1368+a, tdbSNP:376889675
1377+a, gdbSNP:55966164
1404+c, tdbSNP:144185800
1438+dbSNP:
1438+c, tdbSNP:145183977
1470+a, gdbSNP:151016327
1472+c, tdbSNP:200783907
1490+c, tdbSNP:200518498
1550+c, tdbSNP:56225530
1565+c, tdbSNP:371078350
1573+a, gdbSNP:143179681
1584+a, gdbSNP:374432699
1586+c, tdbSNP:200127012
1642+dbSNP:
1642+c, tdbSNP:370364842
1651+g, tdbSNP:144610991
1674+c, tdbSNP:148248559
1675+a, gdbSNP:72550822
1681+a, gdbSNP:55792975
1708+a, c, gdbSNP:3822214
1722+c, tdbSNP:374123328
1725+a, gdbSNP:55986963
1735..1761+dbSNP:
1735..1761+, aaacccatgtatgaagtacagtggaagdbSNP:121913234
1756+a, c, g, tdbSNP:121913235
1759..1773+, aaggttgttgaggagdbSNP:121913510
1759..1767+, aaggttgttdbSNP:121913511
1761+a, gdbSNP:200375589
1762..1764+, gttdbSNP:121913685
1762+a, gdbSNP:121913520
1763+a, c, g, tdbSNP:121913517
1766+a, g, tdbSNP:121913521
1781+g, tdbSNP:200945282
1814+c, tdbSNP:121913513
1834+a, gdbSNP:121913680
1838+g, tdbSNP:28933371
1842+c, tdbSNP:121913515
1868+dbSNP:
1868+c, tdbSNP:375351432
1881+a, tdbSNP:72549292
1887+c, tdbSNP:138380197
1918+c, tdbSNP:369412402
1935+a, gdbSNP:148853099
1940+c, tdbSNP:111466688
1941+a, gdbSNP:199787524
1946+c, tdbSNP:387907217
1947+c, tdbSNP:200814065
1976+dbSNP:
1976+a, gdbSNP:373554876
1987+c, tdbSNP:144369407
2011+a, gdbSNP:121913512
2048+c, tdbSNP:121913523
2077+a, gdbSNP:121913679
2096+c, tdbSNP:121913516
2143+c, tdbSNP:148771698
2144+a, gdbSNP:143772138
2159+c, gdbSNP:35200131
2209+c, tdbSNP:146337870
2219+a, gdbSNP:374262491
2224..2225+, cdbSNP:35826988
2231+dbSNP:
2231+a, gdbSNP:56094246
2232+c, tdbSNP:192110951
2247+a, gdbSNP:372359131
2250+c, tdbSNP:139644803
2295+c, tdbSNP:375902940
2349+dbSNP:
2349+c, tdbSNP:200112919
2350+a, gdbSNP:201165084
2367+c, tdbSNP:55717477
2436+c, tdbSNP:151046591
2445+g, tdbSNP:202144208
2448+c, tdbSNP:140912933
2473+dbSNP:
2473+a, gdbSNP:121913684
2481+c, tdbSNP:55789615
2497+c, tdbSNP:145602440
2533+c, g, tdbSNP:121913506
2534+a, tdbSNP:121913507
2546+a, gdbSNP:121913682
2553+a, tdbSNP:121913514
2561+c, tdbSNP:121913524
2571+c, tdbSNP:141347955
2589+dbSNP:
2589+a, gdbSNP:146992614
2602+a, gdbSNP:121913509
2618+a, gdbSNP:147609111
2626+a, cdbSNP:121913687
2664+c, tdbSNP:371058716
2673+c, gdbSNP:3733542
2688+dbSNP:
2688+c, gdbSNP:143074839
2709+a, gdbSNP:55817813
2713+a, gdbSNP:372795544
2739+g, tdbSNP:374440815
2767+c, tdbSNP:141126803
2815+dbSNP:
2815+g, tdbSNP:190512512
2892+dbSNP:
2892+a, tdbSNP:72549296
2913+c, gdbSNP:149932314
2923+c, tdbSNP:139000082
2934+c, tdbSNP:56288823
2935+a, gdbSNP:146374006
2954+a, gdbSNP:139694927
2967+c, tdbSNP:375833392
2976+c, tdbSNP:200275681
2981+c, tdbSNP:201185750
3007+a, gdbSNP:72549297
3010+a, gdbSNP:373152714
3015+c, gdbSNP:182068450
3035+a, gdbSNP:377596175
3084+g, tdbSNP:112972811
3130..3131+, cdbSNP:141454480
3167+c, tdbSNP:2213181
3235+a, gdbSNP:17084733
3270+g, tdbSNP:376694515
3317+c, gdbSNP:185479436
3334+, cdbSNP:375297569
3370+a, gdbSNP:149336515
3769+c, tdbSNP:376257863
3808+a, gdbSNP:189995563
3857+a, cdbSNP:183497667
3906+c, tdbSNP:188598702
3951+g, tdbSNP:193129140
3962+c, gdbSNP:55799920
4105+c, gdbSNP:144602457
4238+c, tdbSNP:56372445
4252+c, tdbSNP:184041614
4259+a, gdbSNP:114377961
4367+a, gdbSNP:386474127
4367+c, tdbSNP:145007262
4420+a, gdbSNP:1799813
4464+a, cdbSNP:147133269
4503..4506+, aaaadbSNP:374796688
4542+a, gdbSNP:17084736
4648+a, gdbSNP:140416206
4722+a, cdbSNP:386614798
4722+g, tdbSNP:8022
4809+a, gdbSNP:77842054
4818+a, gdbSNP:377361492
4852+a, gdbSNP:186953545
4853+c, tdbSNP:191473270
4946+, tdbSNP:368767153
5035+c, tdbSNP:115028437
Gene SymbolKIT
Gene SynonymC-Kit; CD117; PBT; SCFR
Chromosome4
Locus Map4q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_001093772 Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT), transcript variant 2, mRNA. On-demand $899.00 20
NM_000222 Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT), transcript variant 1, mRNA. In-stock $809.00 $760.00 15
XM_005265740 PREDICTED: Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT), transcript variant X1, mRNA. On-demand $899.00 20
XM_005265741 PREDICTED: Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT), transcript variant X2, mRNA. On-demand $899.00 20
XM_005265742 PREDICTED: Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT), transcript variant X3, mRNA. On-demand $899.00 20
XM_006714038 PREDICTED: Homo sapiens v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog (KIT), transcript variant X4, mRNA. On-demand $699.00 18
Title Structure, domain organization, and different conformational states of stem cell factor-induced intact KIT dimers .
Author Opatowsky Y, Lax I, Tome F, Bleichert F, Unger VM and Schlessinger J.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (5), 1772-1777 (2014)
Title Transitory dasatinib-resistant states in KIT(mut) t(8;21) acute myeloid leukemia cells correlate with altered KIT expression .
Author Herrmann MD, Lennerz JK, Bullinger L, Bartholomae S, Holzmann K, Westhoff MA, Corbacioglu S and Debatin KM.
Journal Exp. Hematol. 42 (2), 90-100 (2014)
Title The FIP1L1-PDGFRA fusion gene and the KIT D816V mutation are coexisting in a small subset of myeloid/lymphoid neoplasms with eosinophilia .
Author Schmitt-Graeff AH, Erben P, Schwaab J, Vollmer-Kary B, Metzgeroth G, Sotlar K, Horny HP, Kreipe HH, Fisch P and Reiter A.
Journal Blood 123 (4), 595-597 (2014)
Title Oncogenic KIT-containing exosomes increase gastrointestinal stromal tumor cell invasion .
Author Atay S, Banskota S, Crow J, Sethi G, Rink L and Godwin AK.
Journal Proc. Natl. Acad. Sci. U.S.A. 111 (2), 711-716 (2014)
Title KIT oncogene inhibition drives intratumoral macrophage M2 polarization .
Author Cavnar MJ, Zeng S, Kim TS, Sorenson EC, Ocuin LM, Balachandran VP, Seifert AM, Greer JB, Popow R, Crawley MH, Cohen NA, Green BL, Rossi F, Besmer P, Antonescu CR and DeMatteo RP.
Journal J. Exp. Med. 210 (13), 2873-2886 (2013)
Title Deletion of the KIT and PDGFRA genes in a patient with piebaldism .
Author Spritz RA, Droetto S and Fukushima Y.
Journal Am. J. Med. Genet. 44 (4), 492-495 (1992)
Title Organization and nucleotide sequence of the human KIT (mast/stem cell growth factor receptor) proto-oncogene .
Author Giebel LB, Strunk KM, Holmes SA and Spritz RA.
Journal Oncogene 7 (11), 2207-2217 (1992)
Title Genomic organization of the human c-kit gene: evolution of the receptor tyrosine kinase subclass III .
Author Andre C, Martin E, Cornu F, Hu WX, Wang XP and Galibert F.
Journal Oncogene 7 (4), 685-691 (1992)
Title p21ras activation via hemopoietin receptors and c-kit requires tyrosine kinase activity but not tyrosine phosphorylation of p21ras GTPase-activating protein .
Author Duronio V, Welham MJ, Abraham S, Dryden P and Schrader JW.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (5), 1587-1591 (1992)
Title Dominant negative and loss of function mutations of the c-kit (mast/stem cell growth factor receptor) proto-oncogene in human piebaldism .
Author Spritz RA, Giebel LB and Holmes SA.
Journal Am. J. Hum. Genet. 50 (2), 261-269 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.