• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens keratin 12 (KRT12), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18523 Homo sapiens keratin 12 (KRT12), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu18523C Homo sapiens keratin 12 (KRT12), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000223.3, 156602658
Length 1485 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens keratin 12 (KRT12), mRNA.
Product keratin, type I cytoskeletal 12
Comment

Summary: KRT12 encodes the type I intermediate filament chain keratin 12, expressed in corneal epithelia. Mutations in this gene lead to Meesmann corneal dystrophy. [provided by RefSeq, Jul 2008].

RefSeq NP_000214.1
CDS 25..1509
Misc Feature(1)25..396
Misc Feature(2)25..396
Misc Feature(3)394..1332
Misc Feature(4)397..1329
Misc Feature(5)397..504
Misc Feature(6)514..570
Misc Feature(7)571..846
Misc Feature(8)847..915
Misc Feature(9)916..1329
Misc Feature(10)1330..1506
Exon (1)592..674
Gene:KRT12
Gene Synonym:K12
Exon (2)675..831
Gene:KRT12
Gene Synonym:K12
Exon (3)832..993
Gene:KRT12
Gene Synonym:K12
Exon (4)994..1119
Gene:KRT12
Gene Synonym:K12
Exon (5)1120..1340
Gene:KRT12
Gene Synonym:K12
Exon (6)1341..1411
Gene:KRT12
Gene Synonym:K12
Exon (7)1412..1992
Gene:KRT12
Gene Synonym:K12
Translation MDLSNNTMSLSVRTPGLSRRLSSQSVIGRPRGMSASSVGSGYGGSAFGFGASCGGGFSAA SMFGSSSGFGGGSGSSMAGGLGAGYGRALGGGSFGGLGMGFGGSPGGGSLGILSGNDGGL LSGSEKETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRGTGTADASQSDYSKYY PLIEDLRNKIISASIGNAQLLLQIDNARLAAEDFRMKYENELALRQGVEADINGLRRVLD ELTLTRTDLEMQIESLNEELAYMKKNHEDELQSFRVGGPGEVSVEMDAAPGVDLTRLLND MRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQ SQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKA RLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNG EVVSSQVQEIEELM
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(36..37)-, gdbSNP:34871978
complement(63)-g, adbSNP:368164077
complement(67)-g, adbSNP:11650915
complement(69)-g, adbSNP:199775745
complement(79)-g, c, adbSNP:200258980
complement(82)-g, adbSNP:17566772
complement(115)-t, adbSNP:367803772
complement(116)-t, cdbSNP:370150894
complement(154)-t, cdbSNP:146312988
complement(184)-t, g, cdbSNP:141949869
complement(187)-g, cdbSNP:371259068
complement(221)-g, cdbSNP:202056647
complement(243)-g, adbSNP:368268437
complement(244)-t, cdbSNP:138169839
complement(306)-g, adbSNP:375825729
complement(321)-t, cdbSNP:144158374
complement(326)-g, adbSNP:150377929
complement(327)-g, adbSNP:370586525
complement(335)-t, cdbSNP:201147294
complement(372)-g, adbSNP:199968040
complement(406)-t, cdbSNP:149532038
409+a, gdbSNP:267607387
410+c, tdbSNP:28936695
413+a, cdbSNP:58864803
423+g, tdbSNP:61167390
427+a, gdbSNP:58410481
428+c, g, tdbSNP:57218384
429+a, cdbSNP:61282718
433+c, gdbSNP:58038639
complement(435)-g, adbSNP:377588934
complement(441)-g, adbSNP:140356245
443+g, tdbSNP:58918655
451+c, g, tdbSNP:58343600
complement(454)-t, gdbSNP:372927571
complement(456)-t, cdbSNP:112885629
complement(461)-g, adbSNP:200829208
complement(464)-t, cdbSNP:202053238
complement(467)-t, cdbSNP:113833263
complement(470)-g, adbSNP:148250043
complement(497)-t, cdbSNP:143115820
complement(501)-t, cdbSNP:371050976
complement(524)-c, adbSNP:74952061
complement(526)-t, adbSNP:377161982
complement(544)-t, cdbSNP:376748271
complement(545)-t, cdbSNP:372779041
complement(547)-t, cdbSNP:200941376
complement(607)-dbSNP:
complement(607)-t, adbSNP:370782072
complement(635)-g, adbSNP:149066278
complement(641)-t, cdbSNP:147584242
complement(663)-g, adbSNP:369049373
complement(679)-dbSNP:
complement(679)-t, cdbSNP:369652357
complement(688)-g, adbSNP:200506470
complement(697)-g, adbSNP:368116028
complement(714)-g, adbSNP:145069399
complement(722)-t, cdbSNP:200678860
complement(730)-g, adbSNP:141121767
complement(739)-g, cdbSNP:199790779
complement(744)-g, adbSNP:374709762
complement(745)-t, cdbSNP:147759075
complement(752)-g, adbSNP:61735165
complement(765)-g, adbSNP:61735166
complement(766)-t, cdbSNP:150674571
complement(772)-g, cdbSNP:200190342
complement(783)-g, adbSNP:372320618
complement(811)-t, cdbSNP:201109047
complement(825)-g, adbSNP:202023486
complement(849)-dbSNP:
complement(849)-t, cdbSNP:142915764
complement(920)-t, cdbSNP:200497999
complement(926)-g, adbSNP:139647784
complement(940)-t, cdbSNP:370559580
complement(952)-t, cdbSNP:188868101
complement(969)-t, gdbSNP:200871858
complement(989)-t, cdbSNP:377505041
complement(997)-dbSNP:
complement(997)-t, cdbSNP:146332400
complement(1029)-t, gdbSNP:141997440
complement(1117)-t, cdbSNP:200354173
complement(1151)-dbSNP:
complement(1151)-g, adbSNP:200553689
complement(1152)-g, cdbSNP:373922617
complement(1180)-t, gdbSNP:201445680
complement(1183)-c, adbSNP:144269064
complement(1191)-t, cdbSNP:144211010
complement(1205)-g, adbSNP:370179526
complement(1223)-t, cdbSNP:367556791
complement(1253)-c, adbSNP:202225978
complement(1266)-t, cdbSNP:140740946
complement(1274)-t, gdbSNP:371629942
1300+a, gdbSNP:59465138
1301+g, tdbSNP:59350319
1309+g, tdbSNP:58162394
1310+a, gdbSNP:59202432
1313+c, gdbSNP:62635290
1322+g, tdbSNP:267607386
complement(1427)-dbSNP:
complement(1427)-t, cdbSNP:74804130
complement(1448)-t, cdbSNP:150149178
complement(1480)-g, cdbSNP:186050235
complement(1516)-t, cdbSNP:375068783
complement(1531)-g, adbSNP:112986245
complement(1545)-t, cdbSNP:375337718
complement(1751)-g, adbSNP:180699112
complement(1781)-g, cdbSNP:192003477
complement(1839)-t, gdbSNP:146258973
complement(1869)-t, gdbSNP:62065925
complement(1917)-t, cdbSNP:139900829
complement(1981..1982)-, gdbSNP:35385537
complement(1985)-, tdbSNP:199542870
Gene SymbolKRT12
Gene SynonymK12
Chromosome17
Locus Map17q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000223 Homo sapiens keratin 12 (KRT12), mRNA. On-demand $219.00 7-9
Title KRT12 mutations and in vivo confocal microscopy in two Japanese families with Meesmann corneal dystrophy .
Author Ogasawara M, Matsumoto Y, Hayashi T, Ohno K, Yamada H, Kawakita T, Dogru M, Shimazaki J, Tsubota K and Tsuneoka H.
Journal Am. J. Ophthalmol. 157 (1), 93-102 (2014)
Title Autosomal-dominant Meesmann epithelial corneal dystrophy without an exon mutation in the keratin-3 or keratin-12 gene in a Chinese family .
Author Cao W, Yan M, Hao Q, Wang S, Wu L, Liu Q, Li M, Biddle FG and Wu W.
Journal J. Int. Med. Res. 41 (2), 511-518 (2013)
Title Severe Meesmann's epithelial corneal dystrophy phenotype due to a missense mutation in the helix-initiation motif of keratin 12 .
Author Hassan H, Thaung C, Ebenezer ND, Larkin G, Hardcastle AJ and Tuft SJ.
Journal Eye (Lond) 27 (3), 367-373 (2013)
Title Allele-specific siRNA silencing for the common keratin 12 founder mutation in Meesmann epithelial corneal dystrophy .
Author Allen EH, Atkinson SD, Liao H, Moore JE, Leslie Pedrioli DM, Smith FJ, McLean WH and Moore CB.
Journal Invest. Ophthalmol. Vis. Sci. 54 (1), 494-502 (2013)
Title Identification of a novel mutation in the cornea specific keratin 12 gene causing Meesmann's corneal dystrophy in a German family .
Author Clausen I, Duncker GI and Grunauer-Kloevekorn C.
Journal Mol. Vis. 16, 954-960 (2010)
Title A novel keratin 12 mutation in a German kindred with Meesmann's corneal dystrophy .
Author Corden LD, Swensson O, Swensson B, Rochels R, Wannke B, Thiel HJ and McLean WH.
Journal Br J Ophthalmol 84 (5), 527-530 (2000)
Title Molecular genetics of Meesmann's corneal dystrophy: ancestral and novel mutations in keratin 12 (K12) and complete sequence of the human KRT12 gene .
Author Corden LD, Swensson O, Swensson B, Smith FJ, Rochels R, Uitto J and McLEAN WH.
Journal Exp. Eye Res. 70 (1), 41-49 (2000)
Title Isolation and chromosomal localization of a cornea-specific human keratin 12 gene and detection of four mutations in Meesmann corneal epithelial dystrophy .
Author Nishida K, Honma Y, Dota A, Kawasaki S, Adachi W, Nakamura T, Quantock AJ, Hosotani H, Yamamoto S, Okada M, Shimomura Y and Kinoshita S.
Journal Am. J. Hum. Genet. 61 (6), 1268-1275 (1997)
Title Mutations in cornea-specific keratin K3 or K12 genes cause Meesmann's corneal dystrophy .
Author Irvine AD, Corden LD, Swensson O, Swensson B, Moore JE, Frazer DG, Smith FJ, Knowlton RG, Christophers E, Rochels R, Uitto J and McLean WH.
Journal Nat. Genet. 16 (2), 184-187 (1997)
Title A gene expression profile of human corneal epithelium and the isolation of human keratin 12 cDNA .
Author Nishida K, Adachi W, Shimizu-Matsumoto A, Kinoshita S, Mizuno K, Matsubara K and Okubo K.
Journal Invest. Ophthalmol. Vis. Sci. 37 (9), 1800-1809 (1996)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.