• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 2, mRNA.


RefSeq Accession Definition Services Price Order
NM_000227 Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 2, mRNA. ORF Sequence $2328.75
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000227.3, 189217423
Length 5623 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 2, mRNA.
Product laminin subunit alpha-3 isoform 2 precursor
Comment

Summary: Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) has an alternate 5' end exon and is missing almost half of the coding exons from the 5' end compared to transcript variant 1. This results in a shorter isoform (2) with a distinct N-terminus compared to isoform 1.

RefSeq NP_000218.2
CDS 26..5200
Misc Feature(1)254..394
Misc Feature(2)257..400
Misc Feature(3)order(257..259,263..265,284..286,305..307,314..316,
Misc Feature(4)395..553
Misc Feature(5)398..550
Misc Feature(6)order(398..400,404..406,434..436,461..463,467..469,
Misc Feature(7)731..1513
Misc Feature(8)2060..2446
Misc Feature(9)2366..2902
Misc Feature(10)3002..3424
Misc Feature(11)3503..3901
Misc Feature(12)4178..4600
Misc Feature(13)4670..5125
Exon (1)1..196
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (2)197..310
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (3)311..420
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (4)421..501
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (5)502..608
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (6)609..659
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (7)660..811
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (8)812..922
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (9)923..1034
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (10)1035..1202
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (11)1203..1399
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (12)1400..1516
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (13)1517..1671
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (14)1672..1813
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (15)1814..1916
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (16)1917..2033
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (17)2034..2213
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (18)2214..2356
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (19)2357..2527
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (20)2528..2679
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (21)2680..2842
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (22)2843..2976
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (23)2977..3121
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (24)3122..3241
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (25)3242..3375
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (26)3376..3493
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (27)3494..3634
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (28)3635..3774
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (29)3775..3906
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (30)3907..4060
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (31)4061..4224
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (32)4225..4408
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (33)4409..4549
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (34)4550..4709
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (35)4710..4840
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (36)4841..4934
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (37)4935..5054
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (38)5055..5618
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Translation MPPAVRRSACSMGWLWIFGAALGQCLGYSSQQQRVPFLQPPGQSQLQASYVEFRPSQGCS PGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHG SCRACPCPHTNSFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSC NSNGQLGSCHPLTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQG LSASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKA QVNSRKAQTLNNNVNRATQSAKELDVKIKNVIRNVHILLKQISGTDGEGNNVPSGDFSRE WAEAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLN EYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADS SLLQTNIALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHARSL QELAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIK EDLPRKAKTLSSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTNLTTL RDGLHGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQNEDFK KALTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAV PMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYI GMAVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTKGATS SKPETPGVYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELDDLNE NVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQTIQTT VDRGLLFFAENGDRFISLNIEDGKLMVRYKLNSELPKERGVGDAINNGRDHSIQIKIGKL QKRMWINVDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVR LNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDH QTWTRNLQVTLEDGYIELSTSDSGSPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQLL RNSKRLKHISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSL NKPPFLMLLKGSTRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHGALQF GDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALG TDGKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLG SPPSGKPKSLPTNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGGPLEKGIYFSEEGGHVV LAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTS VTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLT TLRIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
9+dbSNP:
9+a, gdbSNP:199639611
44+a, cdbSNP:139495056
55+c, tdbSNP:145044428
93+a, gdbSNP:143966308
101+a, cdbSNP:148634422
109+c, tdbSNP:200762475
135+g, tdbSNP:138914132
176..177+, gdbSNP:80356678
210+dbSNP:
210+g, tdbSNP:142097786
242+a, gdbSNP:199975293
245+c, tdbSNP:200944147
247+c, gdbSNP:151202077
273+a, gdbSNP:139258946
318+dbSNP:
318+a, gdbSNP:138168899
331+a, gdbSNP:146514603
347+c, tdbSNP:200046741
367+c, tdbSNP:140561492
376+c, tdbSNP:143755166
382+c, tdbSNP:144191865
388+c, gdbSNP:145159456
438+dbSNP:
438+a, tdbSNP:149170509
454+c, tdbSNP:201107968
458+c, tdbSNP:143265060
510+dbSNP:
510+c, tdbSNP:148353274
511+a, gdbSNP:141738236
520+a, c, gdbSNP:958631
538+c, tdbSNP:138524783
539+a, gdbSNP:199576335
580+a, gdbSNP:142382348
588+a, gdbSNP:201592130
644+dbSNP:
644+a, gdbSNP:199547288
664+dbSNP:
664+c, tdbSNP:149644759
675+a, tdbSNP:79302184
685+a, cdbSNP:150514244
691+c, tdbSNP:199982757
698+a, gdbSNP:138367453
703+a, cdbSNP:149272809
720+a, gdbSNP:144475991
785+a, gdbSNP:201889777
812+dbSNP:
812+a, tdbSNP:200538901
819+c, tdbSNP:139348197
963+dbSNP:
963+a, gdbSNP:117202132
964+c, tdbSNP:144095945
978+c, tdbSNP:146039146
985+c, tdbSNP:76309383
1033+c, tdbSNP:142204005
1047+dbSNP:
1047+a, gdbSNP:147977672
1063+c, tdbSNP:151037092
1079+a, gdbSNP:140913933
1086+c, tdbSNP:181768242
1121+c, tdbSNP:141645580
1122+a, gdbSNP:149809232
1139+c, tdbSNP:34381515
1140+a, gdbSNP:139393175
1141+g, tdbSNP:141778665
1159+g, tdbSNP:34156482
1174+a, gdbSNP:111853751
1184+a, gdbSNP:200180286
1206+dbSNP:
1206+c, tdbSNP:200865470
1301+c, tdbSNP:147083782
1313+c, tdbSNP:138451075
1319+c, gdbSNP:61749941
1320+a, gdbSNP:142656138
1338+c, tdbSNP:143370969
1345+c, gdbSNP:1154226
1356+a, gdbSNP:141145607
1376+a, gdbSNP:141123110
1478+dbSNP:
1478+a, gdbSNP:201661804
1484+a, gdbSNP:150757806
1500+a, tdbSNP:137925254
1571+dbSNP:
1571+a, tdbSNP:112046424
1576+a, gdbSNP:199703255
1587+c, tdbSNP:199684626
1592+g, tdbSNP:34590975
1634+a, gdbSNP:146005577
1637+c, tdbSNP:139893499
1638+a, gdbSNP:201023601
1646+c, gdbSNP:200644027
1656+c, tdbSNP:201935683
1684+dbSNP:
1684+c, tdbSNP:185563091
1690+c, tdbSNP:149747693
1691+a, gdbSNP:139817728
1707+a, gdbSNP:148728856
1723+c, tdbSNP:199949401
1724+a, gdbSNP:142259729
1747+c, tdbSNP:147912032
1753+c, tdbSNP:35872318
1761+c, tdbSNP:145422538
1765+c, tdbSNP:189589322
1772+a, gdbSNP:202152742
1928+dbSNP:
1928+g, tdbSNP:117800082
1986+a, gdbSNP:113351261
1990+c, tdbSNP:200377273
2003+c, gdbSNP:138591939
2006+c, tdbSNP:137852757
2065+dbSNP:
2065+a, gdbSNP:199663037
2073+g, tdbSNP:201267333
2086+c, tdbSNP:141023743
2120+a, cdbSNP:150282408
2141+a, tdbSNP:80356679
2167+a, gdbSNP:201851240
2173+c, tdbSNP:145864582
2174+a, gdbSNP:148831718
2199+a, gdbSNP:112150269
2212+a, gdbSNP:200738951
2250+dbSNP:
2250+a, gdbSNP:199546528
2266+c, gdbSNP:143437938
2287+a, gdbSNP:80105922
2296+a, cdbSNP:142459106
2299+c, tdbSNP:200276517
2308+g, tdbSNP:144636192
2309+g, tdbSNP:138713169
2339+a, gdbSNP:201930248
2374+dbSNP:
2374+g, tdbSNP:145069215
2379+a, gdbSNP:201944973
2416+c, tdbSNP:62093184
2508+c, tdbSNP:150804730
2531+dbSNP:
2531+c, tdbSNP:139190349
2547+g, tdbSNP:184581808
2549+a, cdbSNP:111458614
2562+a, gdbSNP:76571824
2575+c, tdbSNP:61751704
2658+c, tdbSNP:200008950
2663+c, tdbSNP:147463397
2703+dbSNP:
2703+a, gdbSNP:139823161
2717+a, gdbSNP:187899159
2743+c, tdbSNP:145460785
2744+a, gdbSNP:113624323
2759+a, gdbSNP:146061085
2778+c, tdbSNP:200492645
2795+a, cdbSNP:201547061
2845+dbSNP:
2845+c, tdbSNP:148053601
2853+a, gdbSNP:184513844
2859+c, gdbSNP:142392457
2869+a, cdbSNP:151335228
2874+a, gdbSNP:189546268
2901+a, gdbSNP:201625873
2929+c, gdbSNP:192815345
2937+a, cdbSNP:61751705
2938+a, gdbSNP:145848988
2995+dbSNP:
2995+c, tdbSNP:61751706
3016+a, gdbSNP:139567388
3074+a, gdbSNP:201655902
3085+c, tdbSNP:144720616
3103+c, gdbSNP:138571165
3114+a, gdbSNP:149306119
3126+dbSNP:
3126+g, tdbSNP:45516998
3154+a, cdbSNP:201380754
3164+a, gdbSNP:200425910
3215+a, gdbSNP:202110840
3226+c, tdbSNP:35737354
3267+dbSNP:
3267+a, gdbSNP:147208526
3273+a, gdbSNP:139915002
3292+c, tdbSNP:201243058
3298+a, gdbSNP:143830310
3302+a, gdbSNP:9952370
3305+a, gdbSNP:201093281
3311+c, gdbSNP:144373141
3352+a, cdbSNP:149789872
3360+c, tdbSNP:144798744
3402+dbSNP:
3402+a, gdbSNP:201106669
3440+a, gdbSNP:148548958
3480+c, tdbSNP:144549206
3481+a, gdbSNP:146634036
3643+dbSNP:
3643+a, cdbSNP:1154232
3673+c, tdbSNP:143149035
3698+a, gdbSNP:1154233
3741+c, tdbSNP:151133832
3763+c, tdbSNP:140217909
3764+a, gdbSNP:202125814
3775+dbSNP:
3775+a, tdbSNP:140184530
3790+c, tdbSNP:138040650
3794+c, gdbSNP:142161663
3827+c, tdbSNP:35153125
3854+c, tdbSNP:199991488
3862+c, tdbSNP:138908985
3863+a, gdbSNP:188722806
3929+dbSNP:
3929+c, tdbSNP:1131521
3945+a, tdbSNP:147250269
3952+a, cdbSNP:148292143
3971+a, gdbSNP:112986465
4027+a, gdbSNP:141472847
4049+c, tdbSNP:61752346
4083..4084+dbSNP:
4083..4084+, cdbSNP:34754160
4096+c, tdbSNP:141164795
4143+a, cdbSNP:181006797
4150+a, tdbSNP:201972791
4160+c, tdbSNP:137852758
4178+a, cdbSNP:200621862
4318+dbSNP:
4318+a, gdbSNP:201412537
4407+c, tdbSNP:117056996
4417+dbSNP:
4417+c, tdbSNP:200365762
4439+c, tdbSNP:35762515
4471+a, gdbSNP:146163295
4551+dbSNP:
4551+a, gdbSNP:61749943
4588+a, cdbSNP:143872982
4598+c, gdbSNP:139393524
4616+a, gdbSNP:148813524
4634+a, gdbSNP:78615698
4700+g, tdbSNP:184865221
4702+c, tdbSNP:201759849
4723+dbSNP:
4723+a, gdbSNP:201672839
4757+c, tdbSNP:150956802
4758+a, gdbSNP:143170913
4772+a, tdbSNP:115991457
4788+a, gdbSNP:112073265
4805..4806+, gdbSNP:35263487
4847+dbSNP:
4847+a, gdbSNP:141992173
4882+a, gdbSNP:146027333
4927+a, gdbSNP:141464226
4944+dbSNP:
4944+a, gdbSNP:200757779
4979+a, gdbSNP:150364364
5019+a, gdbSNP:138743933
5039+c, tdbSNP:199947949
5057+dbSNP:
5057+a, tdbSNP:192496721
5289+a, cdbSNP:1051149
5291+c, g, tdbSNP:1051150
5320+c, gdbSNP:183887514
5439+a, gdbSNP:45543834
5515..5516+, adbSNP:201747231
5540+c, tdbSNP:188493331
5595+a, tdbSNP:138907590
Gene SymbolLAMA3
Gene SynonymBM600; E170; lama3a; LAMNA; LOCS
Chromosome18
Locus Map18q11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000227 Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 2, mRNA. Full Length $2530.35
ORF Sequence $2328.75
NM_001127717 Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 3, mRNA. Full Length Quote
ORF Sequence Quote
NM_001127718 Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 4, mRNA. Full Length $2454.75
ORF Sequence $2253.15
NM_198129 Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 1, mRNA. Full Length Quote
ORF Sequence Quote
Title Enamel defects in carriers of a novel LAMA3 mutation underlying epidermolysis bullosa .
Author Yuen,W.Y., Pasmooij,A.M., Stellingsma,C. and Jonkman,M.F.
Journal Acta Derm. Venereol. 92 (6), 695-696 (2012)
Title Cell surface proteoglycans syndecan-1 and -4 bind overlapping but distinct sites in laminin alpha3 LG45 protein domain .
Author Carulli,S., Beck,K., Dayan,G., Boulesteix,S., Lortat-Jacob,H. and Rousselle,P.
Journal J. Biol. Chem. 287 (15), 12204-12216 (2012)
Title Invasive breast cancer induces laminin-332 upregulation and integrin beta4 neoexpression in myofibroblasts to confer an anoikis-resistant phenotype during tissue remodeling .
Author Kim,B.G., Gao,M.Q., Choi,Y.P., Kang,S., Park,H.R., Kang,K.S. and Cho,N.H.
Journal Breast Cancer Res. 14 (3), R88 (2012)
Title Polymerized laminin-332 matrix supports rapid and tight adhesion of keratinocytes, suppressing cell migration .
Author Kariya,Y., Sato,H., Katou,N., Kariya,Y. and Miyazaki,K.
Journal PLoS ONE 7 (5), E35546 (2012)
Title The clinical relevance of the expression of the ratio of laminin-5 subchains messenger RNA of hepatocellular carcinoma to non-cancerous liver remnant: a prospective study .
Author Jeng,K.S., Jeng,W.J., Sheen,I.S. and Su,J.C.
Journal Hepatogastroenterology 58 (110-111), 1680-1686 (2011)
Title Cloning of the laminin alpha 3 chain gene (LAMA3) and identification of a homozygous deletion in a patient with Herlitz junctional epidermolysis bullosa .
Author Vidal,F., Baudoin,C., Miquel,C., Galliano,M.F., Christiano,A.M., Uitto,J., Ortonne,J.P. and Meneguzzi,G.
Journal Genomics 30 (2), 273-280 (1995)
Title Structural requirement for cell adhesion to kalinin (laminin-5) .
Author Rousselle,P., Golbik,R., van der Rest,M. and Aumailley,M.
Journal J. Biol. Chem. 270 (23), 13766-13770 (1995)
Title A homozygous nonsense mutation in the alpha 3 chain gene of laminin 5 (LAMA3) in lethal (Herlitz) junctional epidermolysis bullosa .
Author Kivirikko,S., McGrath,J.A., Baudoin,C., Aberdam,D., Ciatti,S., Dunnill,M.G., McMillan,J.R., Eady,R.A., Ortonne,J.P., Meneguzzi,G. et al.
Journal Hum. Mol. Genet. 4 (5), 959-962 (1995)
Title Cloning of the LamA3 gene encoding the alpha 3 chain of the adhesive ligand epiligrin. Expression in wound repair .
Author Ryan,M.C., Tizard,R., VanDevanter,D.R. and Carter,W.G.
Journal J. Biol. Chem. 269 (36), 22779-22787 (1994)
Title A new nomenclature for the laminins .
Author Burgeson,R.E., Chiquet,M., Deutzmann,R., Ekblom,P., Engel,J., Kleinman,H., Martin,G.R., Meneguzzi,G., Paulsson,M., Sanes,J. et al.
Journal Matrix Biol. 14 (3), 209-211 (1994)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878