• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 2, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu20913 Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 2, mRNA. pcDNA3.1+-DYK On-demand $2699.00 30
OHu20913C Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 2, mRNA. Customized vector On-demand $2699.00 30

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000227.3, 189217423
Length 5175 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens laminin, alpha 3 (LAMA3), transcript variant 2, mRNA.
Product laminin subunit alpha-3 isoform 2 precursor
Comment

Summary: Laminins are basement membrane components thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. The protein encoded by this gene is the alpha-3 subunit of laminin 5, which is a complex glycoprotein composed of three subunits (alpha, beta, and gamma). Laminin 5 is thought to be involved in cell adhesion, signal transduction and differentiation of keratinocytes. Mutations in this gene have been identified as the cause of Herlitz type junctional epidermolysis bullosa. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008].


Transcript Variant: This variant (2) has an alternate 5' end exon and is missing almost half of the coding exons from the 5' end compared to transcript variant 1. This results in a shorter isoform (2) with a distinct N-terminus compared to isoform 1.

RefSeq NP_000218.2
CDS 26..5200
Misc Feature(1)254..394
Misc Feature(2)order(257..259,263..265,284..286,305..307,314..316,
Misc Feature(3)395..553
Misc Feature(4)order(398..400,404..406,434..436,461..463,467..469,
Misc Feature(5)731..1513
Misc Feature(6)1220..2362
Misc Feature(7)1247..1678
Misc Feature(8)1472..1966
Misc Feature(9)2060..2446
Misc Feature(10)2366..2902
Misc Feature(11)3002..3424
Misc Feature(12)3503..3901
Misc Feature(13)4178..4600
Misc Feature(14)4670..5125
Exon (1)1..196
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (2)197..310
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (3)311..420
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (4)421..501
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (5)502..608
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (6)609..659
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (7)660..811
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (8)812..922
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (9)923..1034
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (10)1035..1202
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (11)1203..1399
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (12)1400..1516
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (13)1517..1671
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (14)1672..1813
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (15)1814..1916
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (16)1917..2033
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (17)2034..2213
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (18)2214..2356
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (19)2357..2527
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (20)2528..2679
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (21)2680..2842
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (22)2843..2976
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (23)2977..3121
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (24)3122..3241
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (25)3242..3375
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (26)3376..3493
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (27)3494..3634
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (28)3635..3774
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (29)3775..3906
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (30)3907..4060
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (31)4061..4224
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (32)4225..4408
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (33)4409..4549
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (34)4550..4709
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (35)4710..4840
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (36)4841..4934
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (37)4935..5054
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Exon (38)5055..5618
Gene:LAMA3
Gene Synonym:BM600; E170; lama3a; LAMNA; LOCS
Translation MPPAVRRSACSMGWLWIFGAALGQCLGYSSQQQRVPFLQPPGQSQLQASYVEFRPSQGCS PGYYRDHKGLYTGRCVPCNCNGHSNQCQDGSGICVNCQHNTAGEHCERCQEGYYGNAVHG SCRACPCPHTNSFATGCVVNGGDVRCSCKAGYTGTQCERCAPGYFGNPQKFGGSCQPCSC NSNGQLGSCHPLTGDCINQEPKDSSPAEECDDCDSCVMTLLNDLATMGEQLRLVKSQLQG LSASAGLLEQMRHMETQAKDLRNQLLNYRSAISNHGSKIEGLERELTDLNQEFETLQEKA QVNSRKAQTLNNNVNRATQSAKELDVKIKNVIRNVHILLKQISGTDGEGNNVPSGDFSRE WAEAQRMMRELRNRNFGKHLREAEADKRESQLLLNRIRTWQKTHQGENNGLANSIRDSLN EYEAKLSDLRARLQEAAAQAKQANGLNQENERALGAIQRQVKEINSLQSDFTKYLTTADS SLLQTNIALQLMEKSQKEYEKLAASLNEARQELSDKVRELSRSAGKTSLVEEAEKHARSL QELAKQLEEIKRNASGDELVRCAVDAATAYENILNAIKAAEDAANRAASASESALQTVIK EDLPRKAKTLSSNSDKLLNEAKMTQKKLKQEVSPALNNLQQTLNIVTVQKEVIDTNLTTL RDGLHGIQRGDIDAMISSAKSMVRKANDITDEVLDGLNPIQTDVERIKDTYGRTQNEDFK KALTDADNSVNKLTNKLPDLWRKIESINQQLLPLGNISDNMDRIRELIQQARDAASKVAV PMRFNGKSGVEVRLPNDLEDLKGYTSLSLFLQRPNSRENGGTENMFVMYLGNKDASRDYI GMAVVDGQLTCVYNLGDREAELQVDQILTKSETKEAVMDRVKFQRIYQFARLNYTKGATS SKPETPGVYDMDGRNSNTLLNLDPENVVFYVGGYPPDFKLPSRLSFPPYKGCIELDDLNE NVLSLYNFKKTFNLNTTEVEPCRRRKEESDKNYFEGTGYARVPTQPHAPIPTFGQTIQTT VDRGLLFFAENGDRFISLNIEDGKLMVRYKLNSELPKERGVGDAINNGRDHSIQIKIGKL QKRMWINVDVQNTIIDGEVFDFSTYYLGGIPIAIRERFNISTPAFRGCMKNLKKTSGVVR LNDTVGVTKKCSEDWKLVRSASFSRGGQLSFTDLGLPPTDHLQASFGFQTFQPSGILLDH QTWTRNLQVTLEDGYIELSTSDSGSPIFKSPQTYMDGLLHYVSVISDNSGLRLLIDDQLL RNSKRLKHISSSRQSLRLGGSNFEGCISNVFVQRLSLSPEVLDLTSNSLKRDVSLGGCSL NKPPFLMLLKGSTRFNKTKTFRINQLLQDTPVASPRSVKVWQDACSPLPKTQANHGALQF GDIPTSHLLFKLPQELLKPRSQFAVDMQTTSSRGLVFHTGTKNSFMALYLSKGRLVFALG TDGKKLRIKSKEKCNDGKWHTVVFGHDGEKGRLVVDGLRAREGSLPGNSTISIRAPVYLG SPPSGKPKSLPTNSFVGCLKNFQLDSKPLYTPSSSFGVSSCLGGPLEKGIYFSEEGGHVV LAHSVLLGPEFKLVFSIRPRSLTGILIHIGSQPGKHLCVYLEAGKVTASMDSGAGGTSTS VTPKQSLCDGQWHSVAVTIKQHILHLELDTDSSYTAGQIPFPPASTQEPLHLGGAPANLT TLRIPVWKSFFGCLRNIHVNHIPVPVTEALEVQGPVSLNGCPDQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
1+dbSNP:
1+a, gdbSNP:376417551
9+a, gdbSNP:199639611
44+a, cdbSNP:139495056
55+c, tdbSNP:145044428
63+g, tdbSNP:374171592
93+a, gdbSNP:143966308
101+a, cdbSNP:148634422
109+c, tdbSNP:200762475
135+g, tdbSNP:138914132
164+c, tdbSNP:367651246
176..177+, gdbSNP:80356678
176+a, gdbSNP:371292352
210+dbSNP:
210+g, tdbSNP:142097786
219+a, gdbSNP:377076059
242+a, gdbSNP:199975293
245+c, tdbSNP:200944147
247+c, gdbSNP:151202077
273+a, gdbSNP:139258946
318+dbSNP:
318+a, gdbSNP:138168899
329+a, gdbSNP:369226812
330+c, tdbSNP:372471146
331+a, gdbSNP:146514603
347+c, tdbSNP:200046741
367+c, tdbSNP:140561492
376+c, tdbSNP:143755166
382+c, tdbSNP:144191865
388+c, gdbSNP:145159456
438+dbSNP:
438+a, tdbSNP:149170509
444+a, gdbSNP:372354271
454+c, tdbSNP:201107968
458+c, tdbSNP:143265060
459+a, gdbSNP:376167972
510+dbSNP:
510+c, tdbSNP:148353274
511+a, gdbSNP:141738236
complement(520)-g, c, adbSNP:958631
538+c, tdbSNP:138524783
539+a, gdbSNP:199576335
580+a, gdbSNP:142382348
588+a, gdbSNP:201592130
604+c, tdbSNP:368167020
605+a, gdbSNP:371639809
644+dbSNP:
644+a, gdbSNP:199547288
664+dbSNP:
664+c, tdbSNP:149644759
668+a, gdbSNP:377514466
669+c, gdbSNP:377522175
675+a, tdbSNP:79302184
685+a, cdbSNP:150514244
691+c, tdbSNP:199982757
698+a, gdbSNP:138367453
703+a, cdbSNP:149272809
720+a, gdbSNP:144475991
732+c, tdbSNP:373731359
785+a, gdbSNP:201889777
787+a, gdbSNP:371088883
812+dbSNP:
812+a, tdbSNP:200538901
819+c, tdbSNP:139348197
846+a, gdbSNP:374436732
963+dbSNP:
963+a, gdbSNP:117202132
964+c, tdbSNP:144095945
976+a, cdbSNP:376119214
978+c, tdbSNP:146039146
985+c, tdbSNP:76309383
997+a, gdbSNP:370165389
998+c, gdbSNP:375324735
1033+c, tdbSNP:142204005
1047+dbSNP:
1047+a, gdbSNP:147977672
1063+c, tdbSNP:151037092
1079+a, gdbSNP:140913933
1082+a, cdbSNP:367849978
1086+c, tdbSNP:181768242
1087+a, tdbSNP:372411550
1121+c, tdbSNP:141645580
1122+a, gdbSNP:149809232
1124+a, cdbSNP:374243588
1139+c, tdbSNP:34381515
1140+a, gdbSNP:139393175
1141+g, tdbSNP:141778665
1159+g, tdbSNP:34156482
1174+a, gdbSNP:111853751
1184+a, gdbSNP:200180286
1206+dbSNP:
1206+c, tdbSNP:200865470
1211+c, tdbSNP:373250558
1265+a, tdbSNP:376696521
1271+c, tdbSNP:370188105
1292+a, gdbSNP:373464847
1301+c, tdbSNP:369457000
1313+c, tdbSNP:138451075
1319+c, gdbSNP:61749941
1320+a, gdbSNP:142656138
1338+c, tdbSNP:143370969
1345+c, gdbSNP:1154226
1356+a, gdbSNP:141145607
1376+a, gdbSNP:141123110
1478+dbSNP:
1478+a, gdbSNP:201661804
1483+c, tdbSNP:377253260
1484+a, gdbSNP:150757806
1500+a, tdbSNP:137925254
1559+dbSNP:
1559+c, gdbSNP:377267376
1571+a, tdbSNP:112046424
1576+a, gdbSNP:199703255
1587+c, tdbSNP:199684626
1592+g, tdbSNP:34590975
1605+c, tdbSNP:370749309
1634+a, gdbSNP:146005577
1636+a, gdbSNP:369554046
1637+c, tdbSNP:139893499
1638+a, g, tdbSNP:201023601
1646+c, gdbSNP:200644027
1656+c, tdbSNP:201935683
1684+dbSNP:
1684+c, tdbSNP:185563091
1690+c, tdbSNP:149747693
1691+a, gdbSNP:139817728
1707+a, gdbSNP:148728856
1723+c, tdbSNP:199949401
1724+a, gdbSNP:142259729
1747+c, tdbSNP:147912032
1753+c, tdbSNP:35872318
1761+c, tdbSNP:145422538
1765+c, tdbSNP:189589322
1772+a, gdbSNP:202152742
1797+c, tdbSNP:375880671
1891+dbSNP:
1891+g, tdbSNP:367868989
1903+g, tdbSNP:372526880
1928+dbSNP:
1928+g, tdbSNP:117800082
1986+a, gdbSNP:113351261
1990+c, tdbSNP:200377273
1994+c, tdbSNP:368603738
2003+c, gdbSNP:138591939
2006+c, tdbSNP:137852757
2065+dbSNP:
2065+a, gdbSNP:199663037
2073+g, tdbSNP:201267333
2086+c, tdbSNP:141023743
2120+a, cdbSNP:150282408
2132+a, gdbSNP:370191618
2141+a, tdbSNP:80356679
2167+a, gdbSNP:201851240
2173+c, tdbSNP:145864582
2174+a, gdbSNP:148831718
2199+a, gdbSNP:112150269
2212+a, gdbSNP:200738951
2250+dbSNP:
2250+a, gdbSNP:199546528
2266+c, gdbSNP:143437938
2287+a, gdbSNP:80105922
2296+a, cdbSNP:142459106
2299+c, tdbSNP:200276517
2339+a, gdbSNP:201930248
2374+dbSNP:
2374+g, tdbSNP:145069215
2379+a, gdbSNP:201944973
2411+a, gdbSNP:371449908
2416+c, tdbSNP:62093184
2508+c, tdbSNP:150804730
2531+dbSNP:
2531+c, tdbSNP:139190349
2535+a, gdbSNP:374878110
2547+g, tdbSNP:184581808
2549+a, cdbSNP:111458614
2562+a, gdbSNP:76571824
2575+c, tdbSNP:61751704
2631+c, gdbSNP:369668673
2658+c, tdbSNP:200008950
2663+c, tdbSNP:147463397
2703+dbSNP:
2703+a, gdbSNP:139823161
2717+a, gdbSNP:187899159
2734+a, cdbSNP:375987230
2743+c, tdbSNP:145460785
2744+a, gdbSNP:113624323
2759+a, gdbSNP:146061085
2761+c, tdbSNP:373370591
2778+c, tdbSNP:200492645
2795+a, cdbSNP:201547061
2807+c, gdbSNP:377372297
2832+c, gdbSNP:373150935
2845+dbSNP:
2845+c, tdbSNP:148053601
2853+a, gdbSNP:184513844
2856+c, tdbSNP:370161227
2859+c, gdbSNP:142392457
2869+a, cdbSNP:151335228
2874+a, gdbSNP:189546268
2901+a, gdbSNP:201625873
2902+c, tdbSNP:373857286
2921+c, tdbSNP:377097479
2922+a, gdbSNP:370823027
2929+c, gdbSNP:192815345
2937+a, cdbSNP:61751705
2938+a, gdbSNP:145848988
2995+dbSNP:
2995+c, tdbSNP:61751706
3016+a, gdbSNP:139567388
3056+c, tdbSNP:368840701
3074+a, gdbSNP:201655902
3085+c, tdbSNP:144720616
3103+c, gdbSNP:138571165
3114+a, gdbSNP:149306119
3126+dbSNP:
3126+g, tdbSNP:45516998
3141+a, gdbSNP:370722004
3154+a, cdbSNP:201380754
3164+a, gdbSNP:200425910
3215+a, gdbSNP:202110840
3226+c, tdbSNP:35737354
3240+c, tdbSNP:371915321
3267+dbSNP:
3267+a, gdbSNP:147208526
3273+a, gdbSNP:139915002
3292+c, tdbSNP:201243058
3298+a, gdbSNP:143830310
3302+a, gdbSNP:9952370
3305+a, gdbSNP:201093281
3311+c, gdbSNP:144373141
3320+c, gdbSNP:369885228
3352+a, cdbSNP:149789872
3358+a, gdbSNP:373380002
3359+a, gdbSNP:377376620
3360+c, tdbSNP:144798744
3383+dbSNP:
3383+a, gdbSNP:371045141
3402+a, gdbSNP:201106669
3412+a, gdbSNP:374464328
3439+c, tdbSNP:371174542
3440+a, gdbSNP:148548958
3477+a, gdbSNP:374030809
3480+c, tdbSNP:144549206
3481+a, gdbSNP:146634036
3542+dbSNP:
3542+a, gdbSNP:373385653
3643+dbSNP:
3643+a, cdbSNP:1154232
3673+c, tdbSNP:143149035
3698+a, gdbSNP:1154233
3741+c, tdbSNP:151133832
3763+c, tdbSNP:140217909
3764+a, gdbSNP:202125814
3775+dbSNP:
3775+a, tdbSNP:140184530
3794+c, gdbSNP:142161663
3827+c, tdbSNP:35153125
3854+c, tdbSNP:199991488
3862+c, tdbSNP:138908985
3863+a, gdbSNP:188722806
3929+dbSNP:
3929+c, tdbSNP:1131521
3945+a, tdbSNP:147250269
3946+c, tdbSNP:376349138
3948+c, gdbSNP:370263211
3952+a, cdbSNP:148292143
3971+a, gdbSNP:112986465
3995+c, gdbSNP:368093776
4027+a, gdbSNP:141472847
4049+c, tdbSNP:61752346
4050+a, gdbSNP:371662501
4085..4086+dbSNP:
4085..4086+, cdbSNP:34754160
4096+c, tdbSNP:141164795
4143+a, cdbSNP:181006797
4150+a, tdbSNP:201972791
4160+c, tdbSNP:137852758
4178+a, cdbSNP:200621862
4214+c, tdbSNP:377253675
4282+dbSNP:
4282+a, gdbSNP:376536240
4318+a, gdbSNP:201412537
4363+a, gdbSNP:370470226
4407+c, tdbSNP:117056996
4417+dbSNP:
4417+c, tdbSNP:200365762
4439+c, tdbSNP:35762515
4440+a, gdbSNP:374004500
4450+a, gdbSNP:267605131
4471+a, gdbSNP:146163295
4483+a, tdbSNP:367887473
4551+dbSNP:
4551+a, gdbSNP:61749943
4588+a, cdbSNP:143872982
4598+c, gdbSNP:139393524
4602+c, tdbSNP:267605132
4619+c, tdbSNP:267605133
4620+c, tdbSNP:267605134
4633+c, tdbSNP:372697000
4634+a, gdbSNP:78615698
4635+a, gdbSNP:376658794
4700+g, tdbSNP:184865221
4702+c, tdbSNP:201759849
4703+c, gdbSNP:367725541
4711+dbSNP:
4711+c, tdbSNP:370241931
4723+a, gdbSNP:201672839
4757+c, tdbSNP:150956802
4758+a, gdbSNP:143170913
4772+a, tdbSNP:115991457
4788+a, gdbSNP:112073265
4790+a, gdbSNP:377605351
4804+c, tdbSNP:370576353
4807..4808+, gdbSNP:35263487
4847+dbSNP:
4847+a, gdbSNP:141992173
4882+a, gdbSNP:146027333
4893+a, cdbSNP:369545352
4926+c, tdbSNP:373515232
4927+a, gdbSNP:141464226
4944+dbSNP:
4944+a, gdbSNP:200757779
4956+c, tdbSNP:373772529
4979+a, gdbSNP:150364364
5019+a, gdbSNP:138743933
5039+c, tdbSNP:199947949
5057+dbSNP:
5057+a, tdbSNP:192496721
5135+g, tdbSNP:377024118
5142+c, tdbSNP:371453979
5169+c, tdbSNP:367776527
5242+a, gdbSNP:371176897
5289..5291+att, ctcdbSNP:386801660
5289+a, cdbSNP:1051149
5291+c, g, tdbSNP:1051150
5320+c, gdbSNP:183887514
5439+a, gdbSNP:45543834
5515..5516+, adbSNP:201747231
5540+c, tdbSNP:188493331
5595+a, tdbSNP:138907590
Gene SymbolLAMA3
Gene SynonymBM600; E170; lama3a; LAMNA; LOCS
Chromosome18
Locus Map18q11.2
Title The low-abundance transcriptome reveals novel biomarkers, specific intracellular pathways and targetable genes associated with advanced gastric cancer .
Author Bizama C, Benavente F, Salvatierra E, Gutierrez-Moraga A, Espinoza JA, Fernandez EA, Roa I, Mazzolini G, Sagredo EA, Gidekel M and Podhajcer OL.
Journal Int. J. Cancer 134 (4), 755-764 (2014)
Title Detection of novel LAMA3 mutation in Herlitz junctional epidermolysis bullosa in a Jordanian family .
Author Badran EF, Battah HA, Akl KF, Khalil RW and Al Amori I.
Journal Australas. J. Dermatol. 54 (3), 218-221 (2013)
Title Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1 .
Author Ahmeti KB, Ajroud-Driss S, Al-Chalabi A, Andersen PM, Armstrong J, Birve A, Blauw HM, Brown RH, Bruijn L, Chen W, Chio A, Comeau MC, Cronin S, Diekstra FP, Soraya Gkazi A, Glass JD, Grab JD, Groen EJ, Haines JL, Hardiman O, Heller S, Huang J, Hung WY, Jaworski JM, Jones A, Khan H, Landers JE, Langefeld CD, Leigh PN, Marion MC, McLaughlin RL, Meininger V, Melki J, Miller JW, Mora G, Pericak-Vance MA, Rampersaud E, Robberecht W, Russell LP, Salachas F, Saris CG, Shatunov A, Shaw CE, Siddique N, Siddique T, Smith BN, Sufit R, Topp S, Traynor BJ, Vance C, van Damme P, van den Berg LH, van Es MA, van Vught PW, Veldink JH, Yang Y and Zheng JG.
Journal Neurobiol. Aging 34 (1), 357 (2013)
Title Laminin-5 is a biomarker of invasiveness in cervical adenocarcinoma .
Author Imura J, Uchida Y, Nomoto K, Ichikawa K, Tomita S, Iijima T and Fujimori T.
Journal Diagn Pathol 7, 105 (2012)
Title Invasive breast cancer induces laminin-332 upregulation and integrin beta4 neoexpression in myofibroblasts to confer an anoikis-resistant phenotype during tissue remodeling .
Author Kim BG, Gao MQ, Choi YP, Kang S, Park HR, Kang KS and Cho NH.
Journal Breast Cancer Res. 14 (3), R88 (2012)
Title Structural requirement for cell adhesion to kalinin (laminin-5) .
Author Rousselle P, Golbik R, van der Rest M and Aumailley M.
Journal J. Biol. Chem. 270 (23), 13766-13770 (1995)
Title A homozygous nonsense mutation in the alpha 3 chain gene of laminin 5 (LAMA3) in lethal (Herlitz) junctional epidermolysis bullosa .
Author Kivirikko S, McGrath JA, Baudoin C, Aberdam D, Ciatti S, Dunnill MG, McMillan JR, Eady RA, Ortonne JP and Meneguzzi G.
Journal Hum. Mol. Genet. 4 (5), 959-962 (1995)
Title Cloning of the LamA3 gene encoding the alpha 3 chain of the adhesive ligand epiligrin. Expression in wound repair .
Author Ryan MC, Tizard R, VanDevanter DR and Carter WG.
Journal J. Biol. Chem. 269 (36), 22779-22787 (1994)
Title A new nomenclature for the laminins .
Author Burgeson RE, Chiquet M, Deutzmann R, Ekblom P, Engel J, Kleinman H, Martin GR, Meneguzzi G, Paulsson M and Sanes J.
Journal Matrix Biol. 14 (3), 209-211 (1994)
Title Junctional Epidermolysis Bullosa .
Author Pfendner,E.G. and Lucky,A.W.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.