• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens leptin (LEP), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000230 Homo sapiens leptin (LEP), mRNA. GenEZ ORF Cloning In-stock $308.00 $259.00 10

*Business Day

Related Services

RefSeq Version NM_000230.2, 169790920
Length 3444 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens leptin (LEP), mRNA.
Product leptin precursor
Comment

Summary: This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000221.1
CDS 58..561
Misc Feature(1)121..558
Misc Feature(2)121..558
Exon (1)1..29
Gene:LEP
Gene Synonym:LEPD; OB; OBS
Exon (2)30..201
Gene:LEP
Gene Synonym:LEPD; OB; OBS
Exon (3)202..3427
Gene:LEP
Gene Synonym:LEPD; OB; OBS
Translation MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
19+a, gdbSNP:2167270
63+c, tdbSNP:199879263
72+c, gdbSNP:142904532
78+c, tdbSNP:201523305
79+a, gdbSNP:200092598
95+a, cdbSNP:76529182
106+c, tdbSNP:201067336
110+a, gdbSNP:148407750
115+c, gdbSNP:200179130
132+a, gdbSNP:13306517
141+a, gdbSNP:202007341
147+c, tdbSNP:200176785
164+a, gdbSNP:111650508
185+a, cdbSNP:201494642
190+a, gdbSNP:145044661
201+a, gdbSNP:1800583
222+dbSNP:
222+a, gdbSNP:138908051
231+c, tdbSNP:199647957
232+a, gdbSNP:200575914
261+c, gdbSNP:140510728
270+c, tdbSNP:200187656
283+g, tdbSNP:200915360
291+a, gdbSNP:201665158
319+a, tdbSNP:199838573
333+a, gdbSNP:201185232
337+a, gdbSNP:17151919
342+a, cdbSNP:200061184
351+c, tdbSNP:200983754
354+c, tdbSNP:202169453
366+a, c, tdbSNP:28954113
370+c, tdbSNP:104894023
385+a, gdbSNP:1800564
400+a, gdbSNP:201114917
405+c, tdbSNP:202017228
424+a, gdbSNP:200202828
429+c, tdbSNP:201058992
432+a, gdbSNP:199851800
451+c, gdbSNP:200343690
514+a, tdbSNP:201434410
537+c, gdbSNP:75506045
541+a, gdbSNP:191666811
545+g, tdbSNP:199506740
549+c, tdbSNP:200819049
594+c, tdbSNP:62481073
595+a, gdbSNP:28954114
667+a, gdbSNP:200618442
711+a, gdbSNP:28954115
727+c, gdbSNP:200136016
744+c, gdbSNP:201075060
752+c, tdbSNP:201660972
758+c, tdbSNP:199893150
765+c, tdbSNP:113405088
774+c, tdbSNP:202242436
790+c, gdbSNP:28954116
803+g, tdbSNP:140383020
805+a, gdbSNP:201702208
844+a, cdbSNP:200360100
848+a, gdbSNP:28954117
851+c, tdbSNP:199600549
861+c, tdbSNP:191600447
874+c, tdbSNP:201349081
896+a, gdbSNP:199804145
921+a, gdbSNP:200748706
927+a, g, tdbSNP:28954118
934+a, gdbSNP:183801334
949+c, tdbSNP:200861626
955+a, gdbSNP:201995159
961+g, tdbSNP:17151922
965+c, tdbSNP:201188621
976+g, tdbSNP:201395608
1010+c, tdbSNP:200166765
1034+c, tdbSNP:200893037
1050+a, gdbSNP:201721861
1077+a, cdbSNP:200203015
1083+a, gdbSNP:201207134
1101+c, tdbSNP:202240898
1110+c, tdbSNP:200464984
1123+a, gdbSNP:201563706
1142+a, gdbSNP:201990018
1152+a, cdbSNP:111880866
1172+c, gdbSNP:201425072
1191+c, tdbSNP:199614091
1201+a, gdbSNP:200819927
1214+a, cdbSNP:201341056
1226+a, gdbSNP:199838375
1227+a, cdbSNP:200806188
1246+a, gdbSNP:111365240
1258+c, tdbSNP:199878146
1293+c, tdbSNP:200680655
1318+c, tdbSNP:192559065
1342+c, gdbSNP:70940808
1346+a, c, gdbSNP:114834517
1356+g, tdbSNP:148774522
1375+c, tdbSNP:201985046
1377+c, tdbSNP:200206765
1402+a, gdbSNP:201088427
1408+g, tdbSNP:202039764
1414+c, gdbSNP:200167789
1459+g, tdbSNP:201279950
1463+a, gdbSNP:185570072
1468+g, tdbSNP:202164197
1512+a, cdbSNP:200497536
1528+c, tdbSNP:201559406
1546+a, c, gdbSNP:41526944
1550+a, gdbSNP:200931015
1552+a, tdbSNP:201170334
1563+c, g, tdbSNP:199633642
1571+a, cdbSNP:138289049
1575+c, gdbSNP:151325384
1588+c, tdbSNP:200215279
1637+c, gdbSNP:200801798
1649+c, gdbSNP:201924066
1657+c, tdbSNP:199839608
1659+c, tdbSNP:201176555
1685+a, gdbSNP:3750034
1687+a, gdbSNP:202170412
1693+a, cdbSNP:200020946
1709+c, tdbSNP:13306516
1712+a, cdbSNP:201033365
1744+a, gdbSNP:201982184
1746+c, tdbSNP:200556203
1748+a, gdbSNP:139781325
1766+c, tdbSNP:201089993
1767+a, gdbSNP:190525190
1798+c, tdbSNP:200221912
1804+a, gdbSNP:6966536
1806+c, gdbSNP:199847071
1812+a, gdbSNP:200339808
1816+c, tdbSNP:201147488
1821+a, gdbSNP:144195028
1834+a, gdbSNP:200961875
1842+a, gdbSNP:146556007
1850+c, tdbSNP:201773371
1861+c, tdbSNP:199726163
1864+g, tdbSNP:200614624
1872+a, gdbSNP:201676475
1879+c, gdbSNP:200129463
1888+c, tdbSNP:201075088
1935+g, tdbSNP:201919665
1936+g, tdbSNP:28959468
1938+g, tdbSNP:201333921
1952+a, gdbSNP:202155976
1955+g, tdbSNP:200304667
1989+a, cdbSNP:76601079
1996+c, tdbSNP:201699721
2001+c, gdbSNP:200361533
2002+a, gdbSNP:181791569
2022+g, tdbSNP:201153946
2043+c, tdbSNP:199600873
2072+c, tdbSNP:200406083
2088+c, gdbSNP:201435616
2089+c, gdbSNP:28959469
2109+c, tdbSNP:200744739
2110+c, tdbSNP:201701012
2124+c, tdbSNP:199509773
2140+g, tdbSNP:200802392
2185+a, gdbSNP:201769388
2192+c, tdbSNP:200086800
2201+c, tdbSNP:201065449
2220+a, gdbSNP:184444762
2229+a, gdbSNP:200162106
2238+a, cdbSNP:200893300
2239+c, tdbSNP:188857005
2265+, cdbSNP:34052732
2269+a, cdbSNP:199904710
2275+c, tdbSNP:201114403
2281+a, gdbSNP:10954174
2287+a, cdbSNP:200530653
2298+c, tdbSNP:201439123
2299+a, gdbSNP:201949587
2308+c, tdbSNP:200411232
2315+a, cdbSNP:181229468
2316+a, cdbSNP:201426744
2318+a, gdbSNP:199610954
2327+c, tdbSNP:200617385
2328+a, tdbSNP:28959470
2386+c, tdbSNP:199792491
2395..2396+, gdbSNP:200090823
2396+a, gdbSNP:185532950
2402+c, gdbSNP:200916845
2403+a, cdbSNP:201666212
2404+a, gdbSNP:145064090
2422+a, gdbSNP:199879026
2443+a, gdbSNP:200681593
2447+g, tdbSNP:201604408
2457+c, tdbSNP:200054213
2461+a, gdbSNP:201077744
2463+c, tdbSNP:202168818
2464+a, gdbSNP:200128238
2477+c, tdbSNP:201223818
2486+c, tdbSNP:202049573
2511+g, tdbSNP:200171215
2525+a, gdbSNP:41528456
2545+c, gdbSNP:202157113
2555+g, tdbSNP:200527882
2576+a, cdbSNP:28959471
2578+c, tdbSNP:199507100
2582+c, tdbSNP:200822096
2607+a, gdbSNP:41434248
2610+c, tdbSNP:199764881
2614+a, gdbSNP:17617757
2642+a, gdbSNP:201395425
2654+a, gdbSNP:200163732
2668+c, tdbSNP:200866498
2671+g, tdbSNP:187235717
2706+c, tdbSNP:199897743
2742+a, gdbSNP:201230280
2757+g, tdbSNP:201909251
2758+a, gdbSNP:200005103
2760+a, gdbSNP:201012185
2766+a, gdbSNP:41457646
2774+c, tdbSNP:200508994
2785+a, gdbSNP:28959472
2798+a, gdbSNP:202015551
2802+c, gdbSNP:28959473
2806+c, gdbSNP:201052331
2814+a, cdbSNP:11761556
2823+c, tdbSNP:200332242
2831+a, gdbSNP:201089454
2834+c, tdbSNP:199504835
2836+c, tdbSNP:200863221
2864+a, gdbSNP:201999428
2900+g, tdbSNP:199693422
2921+c, tdbSNP:200804321
2936+a, gdbSNP:201666040
2938+c, tdbSNP:200124981
2970+a, gdbSNP:201044899
2971+a, gdbSNP:28959474
2986+c, tdbSNP:199890654
2988+c, tdbSNP:201211541
2991+a, tdbSNP:192232228
2999+c, tdbSNP:202238676
3046+g, tdbSNP:200492704
3064+a, c, tdbSNP:200431904
3067..3069+, aaadbSNP:77922956
3067..3068+, adbSNP:57653562
3067+, adbSNP:112344366
3071+a, gdbSNP:201652474
3082+a, gdbSNP:200356248
3083+a, g, tdbSNP:201177389
3097+a, gdbSNP:199600363
3104+c, gdbSNP:200429168
3107+a, gdbSNP:201335762
3129+a, gdbSNP:199831784
3140+a, c, gdbSNP:200738664
3156+a, cdbSNP:28959475
3167+a, gdbSNP:199500325
3196+a, gdbSNP:200797675
3210+c, tdbSNP:201995058
3255+c, tdbSNP:200071518
3298+c, tdbSNP:200842166
3299+a, gdbSNP:201644572
3308+a, tdbSNP:28959476
3311+g, tdbSNP:200161125
3360+c, tdbSNP:200887574
3365+a, tdbSNP:200515179
3366..3367+, aaadbSNP:67053820
3383..3384+, aaadbSNP:201883268
3383..3384+, aa, aaadbSNP:56247456
3391+a, tdbSNP:199905136
Gene SymbolLEP
Gene SynonymLEPD; OB; OBS
Chromosome7
Locus Map7q31.3
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000230 Homo sapiens leptin (LEP), mRNA. In-stock $308.00 $259.00 10
Title Effects of PPARgamma agonists on the expression of leptin and vascular endothelial growth factor in breast cancer cells .
Author Terrasi,M., Bazan,V., Caruso,S., Insalaco,L., Amodeo,V., Fanale,D., Corsini,L.R., Contaldo,C., Mercanti,A., Fiorio,E., Lo Re,G., Cicero,G., Surmacz,E. and Russo,A.
Journal J. Cell. Physiol. 228 (6), 1368-1374 (2013)
Title Leptin modulates dose-dependently the metabolic and cytolytic activities of NK-92 cells .
Author Lamas,B., Goncalves-Mendes,N., Nachat-Kappes,R., Rossary,A., Caldefie-Chezet,F., Vasson,M.P. and Farges,M.C.
Journal J. Cell. Physiol. 228 (6), 1202-1209 (2013)
Title Locally applied leptin induces regional aortic wall degeneration preceding aneurysm formation in apolipoprotein E-deficient mice .
Author Tao,M., Yu,P., Nguyen,B.T., Mizrahi,B., Savion,N., Kolodgie,F.D., Virmani,R., Hao,S., Ozaki,C.K. and Schneiderman,J.
Journal Arterioscler. Thromb. Vasc. Biol. 33 (2), 311-320 (2013)
Title T cell-derived leptin contributes to increased frequency of T helper type 17 cells in female patients with Hashimoto's thyroiditis .
Author Wang,S., Baidoo,S.E., Liu,Y., Zhu,C., Tian,J., Ma,J., Tong,J., Chen,J., Tang,X., Xu,H. and Lu,L.
Journal Clin. Exp. Immunol. 171 (1), 63-68 (2013)
Title Adiposity, adipokines, and risk of incident stroke in older men .
Author Wannamethee,S.G., Shaper,A.G., Whincup,P.H., Lennon,L. and Sattar,N.
Journal Stroke 44 (1), 3-8 (2013)
Title Structural organization and chromosomal assignment of the human obese gene .
Author Isse,N., Ogawa,Y., Tamura,N., Masuzaki,H., Mori,K., Okazaki,T., Satoh,N., Shigemoto,M., Yoshimasa,Y., Nishi,S. et al.
Journal J. Biol. Chem. 270 (46), 27728-27733 (1995)
Title Human obese gene expression. Adipocyte-specific expression and regional differences in the adipose tissue .
Author Masuzaki,H., Ogawa,Y., Isse,N., Satoh,N., Okazaki,T., Shigemoto,M., Mori,K., Tamura,N., Hosoda,K., Yoshimasa,Y. et al.
Journal Diabetes 44 (7), 855-858 (1995)
Title Positional cloning of the mouse obese gene and its human homologue .
Author Zhang,Y., Proenca,R., Maffei,M., Barone,M., Leopold,L. and Friedman,J.M.
Journal Nature 372 (6505), 425-432 (1994)
Title Molecular mapping of the mouse ob mutation .
Author Friedman,J.M., Leibel,R.L., Siegel,D.S., Walsh,J. and Bahary,N.
Journal Genomics 11 (4), 1054-1062 (1991)
Title Fatty acid activation: specificity, localization, and function .
Author Groot,P.H., Scholte,H.R. and Hulsmann,W.C.
Journal Adv. Lipid Res. 14, 75-126 (1976)


Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Learn more about the GenEZ ORF Cloning Service.