Homo sapiens leptin (LEP), mRNA.
| RefSeq Version | NM_000230.2, 169790920 |
| Length | 3444 bp |
| Structure | linear |
| Update Date | 24-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens leptin (LEP), mRNA. |
| Product | leptin precursor |
| Comment | Summary: This gene encodes a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake and/or regulate energy expenditure to maintain constancy of the adipose mass. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis and wound healing. Mutations in this gene and/or its regulatory regions cause severe obesity, and morbid obesity with hypogonadism. This gene has also been linked to type 2 diabetes mellitus development. [provided by RefSeq]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. |
| RefSeq | NP_000221.1 |
| CDS | 58..561 | Exon (1) | 1..29 | Exon (2) | 1..29 | Exon (3) | 30..201 | Exon (4) | 202..3427 |
| Translation | MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Title | Association of adiponectin and leptin with serum lipids and erythrocyte omega-3 and omega-6 fatty acids in dialysis patients . |
| Author | An,W.S., Son,Y.K., Kim,S.E., Kim,K.H., Bae,H.R., Lee,S., Park,Y., Kim,H.J. and Vaziri,N.D. |
| Journal | Clin. Nephrol. 75 (3), 195-203 (2011) |
| Title | Development and characterization of high affinity leptins and leptin antagonists . |
| Author | Shpilman,M., Niv-Spector,L., Katz,M., Varol,C., Solomon,G., Ayalon-Soffer,M., Boder,E., Halpern,Z., Elinav,E. and Gertler,A. |
| Journal | J. Biol. Chem. 286 (6), 4429-4442 (2011) |
| Title | Leptin rapidly improves glucose homeostasis in obese mice by increasing hypothalamic insulin sensitivity . |
| Author | Koch,C., Augustine,R.A., Steger,J., Ganjam,G.K., Benzler,J., Pracht,C., Lowe,C., Schwartz,M.W., Shepherd,P.R., Anderson,G.M., Grattan,D.R. and Tups,A. |
| Journal | J. Neurosci. 30 (48), 16180-16187 (2010) |
| Title | Serum levels of adipokines resistin and leptin in patients with colon cancer . |
| Author | Salageanu,A., Tucureanu,C., Lerescu,L., Caras,I., Pitica,R., Gangura,G., Costea,R. and Neagu,S. |
| Journal | J Med Life 3 (4), 416-420 (2010) |
| Title | Association of ghrelin and leptin with reproductive hormones in constitutional delay of growth and puberty . |
| Author | El-Eshmawy,M.M., Abdel Aal,I.A. and El Hawary,A.K. |
| Journal | Reprod. Biol. Endocrinol. 8, 153 (2010) |
| Title | Structural organization and chromosomal assignment of the human obese gene . |
| Author | Isse,N., Ogawa,Y., Tamura,N., Masuzaki,H., Mori,K., Okazaki,T., Satoh,N., Shigemoto,M., Yoshimasa,Y., Nishi,S. et al. |
| Journal | J. Biol. Chem. 270 (46), 27728-27733 (1995) |
| Title | Human obese gene expression. Adipocyte-specific expression and regional differences in the adipose tissue . |
| Author | Masuzaki,H., Ogawa,Y., Isse,N., Satoh,N., Okazaki,T., Shigemoto,M., Mori,K., Tamura,N., Hosoda,K., Yoshimasa,Y. et al. |
| Journal | Diabetes 44 (7), 855-858 (1995) |
| Title | Positional cloning of the mouse obese gene and its human homologue . |
| Author | Zhang,Y., Proenca,R., Maffei,M., Barone,M., Leopold,L. and Friedman,J.M. |
| Journal | Nature 372 (6505), 425-432 (1994) |
| Title | Molecular mapping of the mouse ob mutation . |
| Author | Friedman,J.M., Leibel,R.L., Siegel,D.S., Walsh,J. and Bahary,N. |
| Journal | Genomics 11 (4), 1054-1062 (1991) |
| Title | Fatty acid activation: specificity, localization, and function . |
| Author | Groot,P.H., Scholte,H.R. and Hulsmann,W.C. |
| Journal | Adv. Lipid Res. 14, 75-126 (1976) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |