• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu47254 Homo sapiens sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), mRNA. pcDNA3.1+-DYK On-demand $159.00 7-9
OHu47254C Homo sapiens sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), mRNA. Customized vector On-demand $209.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000231.2, 209529740
Length 876 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), mRNA.
Product gamma-sarcoglycan
Comment

Summary: This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). [provided by RefSeq, Oct 2008].

RefSeq NP_000222.1
CDS 156..1031
Misc Feature(1)72..74
Misc Feature(2)222..1007
Misc Feature(3)222..1007
Misc Feature(4)267..329
Exon (1)1..155
Gene:SGCG
Gene Synonym:A4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Exon (2)156..350
Gene:SGCG
Gene Synonym:A4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Exon (3)351..452
Gene:SGCG
Gene Synonym:A4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Exon (4)453..540
Gene:SGCG
Gene Synonym:A4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Exon (5)541..660
Gene:SGCG
Gene Synonym:A4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Exon (6)661..733
Gene:SGCG
Gene Synonym:A4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Exon (7)734..857
Gene:SGCG
Gene Synonym:A4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Exon (8)858..1655
Gene:SGCG
Gene Synonym:A4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Translation MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKV MWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEG EVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVE TPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAE TVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHSHICL
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
68+a, gdbSNP:4770403
121+a, gdbSNP:372088302
150+c, tdbSNP:141771521
162+dbSNP:
162+c, tdbSNP:140310896
163+a, gdbSNP:35105771
172+a, gdbSNP:148041867
221+c, tdbSNP:376410504
236+c, tdbSNP:202078221
249+a, gdbSNP:76916029
257+c, tdbSNP:140810408
267+c, tdbSNP:1800349
297+a, gdbSNP:369936288
312+c, tdbSNP:138880406
321+a, tdbSNP:373083509
367+dbSNP:
367+c, tdbSNP:143009120
383+c, tdbSNP:1800350
390+c, tdbSNP:148404730
391+a, gdbSNP:375766013
392+c, tdbSNP:201144588
422+a, gdbSNP:149595403
425+g, tdbSNP:368524463
458+dbSNP:
458+a, cdbSNP:144277094
459+c, tdbSNP:201683351
467+g, tdbSNP:1800351
473+a, gdbSNP:371622125
481+a, gdbSNP:201514102
500+a, gdbSNP:1800352
501+c, tdbSNP:191040430
502+a, gdbSNP:17314986
509+a, gdbSNP:376184429
526+g, tdbSNP:183204936
534+a, cdbSNP:368149615
583+dbSNP:
583+a, gdbSNP:369818411
590+c, tdbSNP:35628352
591+a, gdbSNP:373442790
593+c, tdbSNP:144497243
594+a, gdbSNP:374836520
605+a, gdbSNP:369191957
610+c, tdbSNP:201329880
621+a, gdbSNP:181210672
662+dbSNP:
662+g, tdbSNP:199905729
677+c, tdbSNP:146679977
684+c, tdbSNP:375592456
690+a, gdbSNP:139072866
694+a, tdbSNP:114160429
719+a, gdbSNP:367595212
751+dbSNP:
751+a, gdbSNP:200191311
770+a, cdbSNP:142409090
783+a, cdbSNP:368027244
808+c, tdbSNP:202045534
810+a, gdbSNP:375904616
812+c, gdbSNP:368393587
825+a, gdbSNP:372188878
860+dbSNP:
860+c, tdbSNP:1800353
861+a, gdbSNP:201788230
871+c, tdbSNP:149086397
890+c, tdbSNP:373785384
892+a, gdbSNP:377625551
906+a, gdbSNP:201535503
942+a, gdbSNP:104894423
947+c, gdbSNP:377620885
958+c, tdbSNP:143110015
987+a, gdbSNP:147820869
1003+a, gdbSNP:104894422
1010+a, gdbSNP:370309494
1015+a, gdbSNP:1800354
1041+a, gdbSNP:139369964
1044+c, tdbSNP:9510701
1084+a, cdbSNP:188804783
1085+c, tdbSNP:193022162
1132+a, cdbSNP:75252896
1144..1158+, ccagaggaactcagadbSNP:149533619
complement(1167)-t, g, adbSNP:3751372
1176+c, gdbSNP:150043089
complement(1198)-t, cdbSNP:145339454
1216+a, gdbSNP:115918628
complement(1285)-t, cdbSNP:3751371
1285+a, gdbSNP:386585450
1322+a, gdbSNP:373623927
complement(1326)-g, adbSNP:3829352
1327+a, gdbSNP:115862132
1333+g, tdbSNP:78718194
1340+c, tdbSNP:377364360
1509+a, cdbSNP:184625354
1536+a, gdbSNP:7329620
1542+c, gdbSNP:372148320
1577+c, tdbSNP:41283956
complement(1643)-g, adbSNP:147879467
Gene SymbolSGCG
Gene SynonymA4; DAGA4; DMDA; DMDA1; LGMD2C; MAM; SCARMD2; SCG3; TYPE
Chromosome13
Locus Map13q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000231 Homo sapiens sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), mRNA. On-demand $159.00 7-9
XM_006719861 PREDICTED: Homo sapiens sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), transcript variant X2, mRNA. On-demand $159.00 7-9
XM_005266505 PREDICTED: Homo sapiens sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) (SGCG), transcript variant X1, mRNA. On-demand $159.00 7-9
Title Genome-wide association study identifies a novel locus contributing to type 2 diabetes susceptibility in Sikhs of Punjabi origin from India .
Author Saxena R, Saleheen D, Been LF, Garavito ML, Braun T, Bjonnes A, Young R, Ho WK, Rasheed A, Frossard P, Sim X, Hassanali N, Radha V, Chidambaram M, Liju S, Rees SD, Ng DP, Wong TY, Yamauchi T, Hara K, Tanaka Y, Hirose H, McCarthy MI, Morris AP, Basit A, Barnett AH, Katulanda P, Matthews D, Mohan V, Wander GS, Singh JR, Mehra NK, Ralhan S, Kamboh MI, Mulvihill JJ, Maegawa H, Tobe K, Maeda S, Cho YS, Tai ES, Kelly MA, Chambers JC, Kooner JS, Kadowaki T, Deloukas P, Rader DJ, Danesh J and Sanghera DK.
Journal Diabetes 62 (5), 1746-1755 (2013)
Title Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus .
Author Lu Y, Vitart V, Burdon KP, Khor CC, Bykhovskaya Y, Mirshahi A, Hewitt AW, Koehn D, Hysi PG, Ramdas WD, Zeller T, Vithana EN, Cornes BK, Tay WT, Tai ES, Cheng CY, Liu J, Foo JN, Saw SM, Thorleifsson G, Stefansson K, Dimasi DP, Mills RA, Mountain J, Ang W, Hoehn R, Verhoeven VJ, Grus F, Wolfs R, Castagne R, Lackner KJ, Springelkamp H, Yang J, Jonasson F, Leung DY, Chen LJ, Tham CC, Rudan I, Vatavuk Z, Hayward C, Gibson J, Cree AJ, MacLeod A, Ennis S, Polasek O, Campbell H, Wilson JF, Viswanathan AC, Fleck B, Li X, Siscovick D, Taylor KD, Rotter JI, Yazar S, Ulmer M, Li J, Yaspan BL, Ozel AB, Richards JE, Moroi SE, Haines JL, Kang JH, Pasquale LR, Allingham RR, Ashley-Koch A, Mitchell P, Wang JJ, Wright AF, Pennell C, Spector TD, Young TL, Klaver CC, Martin NG, Montgomery GW, Anderson MG, Aung T, Willoughby CE, Wiggs JL, Pang CP, Thorsteinsdottir U, Lotery AJ, Hammond CJ, van Duijn CM, Hauser MA, Rabinowitz YS, Pfeiffer N, Mackey DA, Craig JE, Macgregor S and Wong TY.
Journal Nat. Genet. 45 (2), 155-163 (2013)
Title A delta-sarcoglycan gene polymorphism as a risk factor for hypertrophic cardiomyopathy .
Author Ordonez-Razo RM, Garrido-Garduno MH, Perez-Martinez RA, Ruiz VM, Herrera-Tepatlan E, Rodriguez-Cruz M, Jimenez-Vaca AL, Minauro-Sanmiguel F and Salamanca-Gomez FA.
Journal Genet Test Mol Biomarkers 16 (8), 855-858 (2012)
Title Genome-wide significant association between alcohol dependence and a variant in the ADH gene cluster .
Author Frank J, Cichon S, Treutlein J, Ridinger M, Mattheisen M, Hoffmann P, Herms S, Wodarz N, Soyka M, Zill P, Maier W, Mossner R, Gaebel W, Dahmen N, Scherbaum N, Schmal C, Steffens M, Lucae S, Ising M, Muller-Myhsok B, Nothen MM, Mann K, Kiefer F and Rietschel M.
Journal Addict Biol 17 (1), 171-180 (2012)
Title Genome-wide association of bipolar disorder suggests an enrichment of replicable associations in regions near genes .
Author Smith EN, Koller DL, Panganiban C, Szelinger S, Zhang P, Badner JA, Barrett TB, Berrettini WH, Bloss CS, Byerley W, Coryell W, Edenberg HJ, Foroud T, Gershon ES, Greenwood TA, Guo Y, Hipolito M, Keating BJ, Lawson WB, Liu C, Mahon PB, McInnis MG, McMahon FJ, McKinney R, Murray SS, Nievergelt CM, Nurnberger JI Jr, Nwulia EA, Potash JB, Rice J, Schulze TG, Scheftner WA, Shilling PD, Zandi PP, Zollner S, Craig DW, Schork NJ and Kelsoe JR.
Journal PLoS Genet. 7 (6), E1002134 (2011)
Title Mild and severe muscular dystrophy caused by a single gamma-sarcoglycan mutation .
Author McNally EM, Passos-Bueno MR, Bonnemann CG, Vainzof M, de Sa Moreira E, Lidov HG, Othmane KB, Denton PH, Vance JM, Zatz M and Kunkel LM.
Journal Am. J. Hum. Genet. 59 (5), 1040-1047 (1996)
Title Absence of gamma-sarcoglycan (35 DAG) in autosomal recessive muscular dystrophy linked to chromosome 13q12 .
Author Jung D, Leturcq F, Sunada Y, Duclos F, Tome FM, Moomaw C, Merlini L, Azibi K, Chaouch M, Slaughter C, Fardeau M, Kaplan JC and Campbell KP.
Journal FEBS Lett. 381 (1-2), 15-20 (1996)
Title Mutations in the dystrophin-associated protein gamma-sarcoglycan in chromosome 13 muscular dystrophy .
Author Noguchi S, McNally EM, Ben Othmane K, Hagiwara Y, Mizuno Y, Yoshida M, Yamamoto H, Bonnemann CG, Gussoni E, Denton PH, Kyriakides T, Middleton L, Hentati F, Ben Hamida M, Nonaka I, Vance JM, Kunkel LM and Ozawa E.
Journal Science 270 (5237), 819-822 (1995)
Title Evidence for linkage disequilibrium in chromosome 13-linked Duchenne-like muscular dystrophy (LGMD2C) .
Author Ben Othmane,K., Speer,M.C., Stauffer,J., Blel,S., Middleton,L., Ben Hamida,C., Etribi,A., Loeb,D., Hentati,F., Roses,A.D. et al.
Journal Am. J. Hum. Genet. 57 (3), 732-734 (1995)
Title Linkage disequilibrium in the neurofibromatosis 1 (NF1) region: implications for gene mapping .
Author Jorde LB, Watkins WS, Viskochil D, O'Connell P and Ward K.
Journal Am. J. Hum. Genet. 53 (5), 1038-1050 (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.