• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu38626 Homo sapiens sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu38626C Homo sapiens sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000232.4, 209693454
Length 957 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), mRNA.
Product beta-sarcoglycan
Comment

Summary: This gene encodes a member of the sarcoglycan family. Sarcoglycans are transmembrane components in the dystrophin-glycoprotein complex which help stabilize the muscle fiber membranes and link the muscle cytoskeleton to the extracellular matrix. Mutations in this gene have been associated with limb-girdle muscular dystrophy.[provided by RefSeq, Oct 2008].

RefSeq NP_000223.1
CDS 61..1017
Misc Feature(1)214..984
Misc Feature(2)214..984
Misc Feature(3)256..318
Exon (1)1..93
Gene:SGCB
Gene Synonym:A3b; LGMD2E; SGC
Exon (2)94..303
Gene:SGCB
Gene Synonym:A3b; LGMD2E; SGC
Exon (3)304..489
Gene:SGCB
Gene Synonym:A3b; LGMD2E; SGC
Exon (4)490..681
Gene:SGCB
Gene Synonym:A3b; LGMD2E; SGC
Exon (5)682..813
Gene:SGCB
Gene Synonym:A3b; LGMD2E; SGC
Exon (6)814..4279
Gene:SGCB
Gene Synonym:A3b; LGMD2E; SGC
Translation MAAAAAAAAEQQSSNGPVKKSMREKAVERRSVNKEHNSNFKAGYIPIDEDRLHKTGLRGR KGNLAICVIILLFILAVINLIITLVIWAVIRIGPNGCDSMEFHESGLLRFKQVSDMGVIH PLYKSTVGGRRNENLVITGNNQPIVFQQGTTKLSVENNKTSITSDIGMQFFDPRTQNILF STDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGNEGVFIMGKTIE FHMGGNMELKAENSIILNGSVMVSTTRLPSSSSGDQLGSGDWVRYKLCMCADGTLFKVQV TSQNMGCQISDNPCGNTH
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
41+dbSNP:
41+, gdbSNP:398123261
complement(43)-t, cdbSNP:368914658
61+a, gdbSNP:398123262
complement(101)-dbSNP:
complement(101)-t, gdbSNP:373470798
143+a, gdbSNP:11541944
complement(143)-g, adbSNP:386518824
complement(147)-t, cdbSNP:370052058
150+g, tdbSNP:11541942
complement(152)-c, adbSNP:115928999
complement(197)-g, adbSNP:148525453
complement(207)-t, cdbSNP:113417835
complement(211)-g, adbSNP:144743676
complement(212)-t, cdbSNP:143751283
complement(248)-t, cdbSNP:377071680
complement(286)-t, cdbSNP:140134296
complement(298)-c, adbSNP:146150527
complement(304)-dbSNP:
complement(304)-t, cdbSNP:143106297
complement(311)-g, adbSNP:138367908
332+c, g, tdbSNP:104893869
359+a, tdbSNP:104893871
383+g, tdbSNP:104893870
complement(401)-g, adbSNP:150518260
complement(423)-t, adbSNP:150804702
428+a, cdbSNP:398123263
complement(429)-g, adbSNP:371706268
436+a, gdbSNP:11541943
complement(452)-t, cdbSNP:201439705
complement(491)-dbSNP:
complement(491)-c, adbSNP:147995730
complement(503)-t, cdbSNP:201006370
512+c, gdbSNP:28936383
complement(539)-g, adbSNP:146960385
complement(547)-t, cdbSNP:116157710
complement(548)-g, adbSNP:368795726
complement(555)-g, adbSNP:142801720
complement(556)-t, cdbSNP:138877636
612+g, tdbSNP:104893868
complement(618)-c, adbSNP:200167048
complement(666)-g, cdbSNP:201931208
complement(673)-t, adbSNP:202114068
complement(689)-dbSNP:
complement(689)-c, adbSNP:370286565
complement(779)-t, adbSNP:200018958
complement(812)-g, adbSNP:146111013
complement(828)-dbSNP:
complement(828)-g, adbSNP:149121189
complement(845)-g, adbSNP:201923065
complement(849)-g, adbSNP:371225165
complement(854)-g, adbSNP:116214830
complement(858)-t, gdbSNP:182784793
complement(859)-g, adbSNP:200761715
complement(860)-t, cdbSNP:114778658
complement(901)-t, cdbSNP:374923265
complement(964)-t, cdbSNP:113313283
complement(990)-t, cdbSNP:145108543
complement(999)-g, adbSNP:375438506
complement(1003)-t, cdbSNP:150395645
complement(1028)-g, cdbSNP:75548192
complement(1035)-g, cdbSNP:191486389
complement(1115)-g, adbSNP:371208586
complement(1312)-t, cdbSNP:188088101
complement(1321)-t, cdbSNP:183259387
complement(1431)-t, gdbSNP:190941869
complement(1483)-g, adbSNP:377083884
1538+a, tdbSNP:225165
complement(1562)-t, adbSNP:185150054
complement(1582)-t, cdbSNP:181924442
complement(1651)-g, adbSNP:375138885
complement(1741)-g, adbSNP:79282232
complement(1750)-c, adbSNP:369954831
complement(1774)-c, adbSNP:190910095
complement(1791)-g, adbSNP:186149099
complement(1930)-g, adbSNP:181701724
complement(2006)-t, gdbSNP:375922380
complement(2011)-t, gdbSNP:71595670
complement(2060)-t, cdbSNP:190163610
complement(2066)-t, cdbSNP:114153585
complement(2122)-t, cdbSNP:77404139
complement(2130)-t, cdbSNP:76630071
complement(2142)-t, adbSNP:146235069
complement(2261)-t, adbSNP:184970220
2396+a, gdbSNP:142057805
complement(2447)-g, adbSNP:181308680
complement(2518)-g, cdbSNP:189219427
2583+c, tdbSNP:13989
2641+c, tdbSNP:225163
complement(2751)-t, cdbSNP:376828672
complement(2775)-g, cdbSNP:2613114
complement(2885)-t, gdbSNP:183468357
complement(2894)-, adbSNP:140630902
complement(2897)-g, adbSNP:192592642
complement(2930)-g, adbSNP:148314727
complement(2948)-g, adbSNP:187619233
complement(2980..2983)-, taaadbSNP:147275302
complement(3113)-g, adbSNP:184651316
complement(3114)-c, adbSNP:170424
complement(3164..3165)-, gdbSNP:370336900
complement(3183)-g, adbSNP:192993435
complement(3303)-t, adbSNP:116538326
complement(3333)-t, cdbSNP:188616784
complement(3364)-g, adbSNP:143238686
complement(3443..3444)-, cdbSNP:34667600
complement(3553)-g, adbSNP:113612476
complement(3598)-t, cdbSNP:111472806
complement(3770)-g, adbSNP:149137189
complement(3872)-t, adbSNP:112693657
complement(3890)-t, cdbSNP:183042117
3924+a, gdbSNP:138349341
complement(4060)-t, cdbSNP:73246100
complement(4119)-t, adbSNP:191235935
complement(4155..4156)-, cdbSNP:34155563
complement(4210)-g, cdbSNP:186866895
complement(4275)-g, cdbSNP:182133472
complement(4277)-t, adbSNP:141778535
Gene SymbolSGCB
Gene SynonymA3b; LGMD2E; SGC
Chromosome4
Locus Map4q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000232 Homo sapiens sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), mRNA. In-stock $99.00 5-7
XM_006714046 PREDICTED: Homo sapiens sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), transcript variant X1, mRNA. On-demand $159.00 7-9
XM_006714047 PREDICTED: Homo sapiens sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), transcript variant X2, mRNA. On-demand $159.00 7-9
XM_006714048 PREDICTED: Homo sapiens sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), transcript variant X3, mRNA. On-demand $159.00 7-9
XM_006714049 PREDICTED: Homo sapiens sarcoglycan, beta (43kDa dystrophin-associated glycoprotein) (SGCB), transcript variant X4, mRNA. On-demand $159.00 7-9
Title Sarcoglycanopathies: can muscle immunoanalysis predict the genotype? .
Author Klinge L, Dekomien G, Aboumousa A, Charlton R, Epplen JT, Barresi R, Bushby K and Straub V.
Journal Neuromuscul. Disord. 18 (12), 934-941 (2008)
Title Expression of the dystrophin-glycoprotein complex is a marker for human airway smooth muscle phenotype maturation .
Author Sharma P, Tran T, Stelmack GL, McNeill K, Gosens R, Mutawe MM, Unruh H, Gerthoffer WT and Halayko AJ.
Journal Am. J. Physiol. Lung Cell Mol. Physiol. 294 (1), L57-L68 (2008)
Title The beta-delta-core of sarcoglycan is essential for deposition at the plasma membrane .
Author Draviam RA, Shand SH and Watkins SC.
Journal Muscle Nerve 34 (6), 691-701 (2006)
Title Muscle protein analysis in the detection of heterozygotes for recessive limb girdle muscular dystrophy type 2B and 2E .
Author Fanin M, Nascimbeni AC and Angelini C.
Journal Neuromuscul. Disord. 16 (11), 792-799 (2006)
Title Homozygous microdeletion of chromosome 4q11-q12 causes severe limb-girdle muscular dystrophy type 2E with joint hyperlaxity and contractures .
Author Kaindl AM, Jakubiczka S, Lucke T, Bartsch O, Weis J, Stoltenburg-Didinger G, Aksu F, Oexle K, Koehler K and Huebner A.
Journal Hum. Mutat. 26 (3), 279-280 (2005)
Title Mutations in the sarcoglycan genes in patients with myopathy .
Author Duggan DJ, Gorospe JR, Fanin M, Hoffman EP and Angelini C.
Journal N. Engl. J. Med. 336 (9), 618-624 (1997)
Title Genomic screening for beta-sarcoglycan gene mutations: missense mutations may cause severe limb-girdle muscular dystrophy type 2E (LGMD 2E) .
Author Bonnemann CG, Passos-Bueno MR, McNally EM, Vainzof M, de Sa Moreira E, Marie SK, Pavanello RC, Noguchi S, Ozawa E, Zatz M and Kunkel LM.
Journal Hum. Mol. Genet. 5 (12), 1953-1961 (1996)
Title Beta-sarcoglycan (A3b) mutations cause autosomal recessive muscular dystrophy with loss of the sarcoglycan complex .
Author Bonnemann CG, Modi R, Noguchi S, Mizuno Y, Yoshida M, Gussoni E, McNally EM, Duggan DJ, Angelini C and Hoffman EP.
Journal Nat. Genet. 11 (3), 266-273 (1995)
Title Beta-sarcoglycan: characterization and role in limb-girdle muscular dystrophy linked to 4q12 .
Author Lim LE, Duclos F, Broux O, Bourg N, Sunada Y, Allamand V, Meyer J, Richard I, Moomaw C and Slaughter C.
Journal Nat. Genet. 11 (3), 257-265 (1995)
Title Glycoprotein complex anchoring dystrophin to sarcolemma .
Author Yoshida M and Ozawa E.
Journal J. Biochem. 108 (5), 748-752 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.