• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lipase, hepatic (LIPC), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000236 Homo sapiens lipase, hepatic (LIPC), mRNA. GenEZ ORF Cloning On-demand $699.00 18

*Business Day

Related Services

RefSeq Version NM_000236.2, 194097334
Length 1614 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens lipase, hepatic (LIPC), mRNA.
Product hepatic triacylglycerol lipase precursor
Comment

Summary: LIPC encodes hepatic triglyceride lipase, which is expressed in liver. LIPC has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. [provided by RefSeq, Jul 2008].

RefSeq NP_000227.2
CDS 58..1557
Misc Feature(1)46..48
Misc Feature(2)202..1092
Misc Feature(3)241..1548
Misc Feature(4)553..567
Misc Feature(5)order(559..561,637..639,892..894)
Misc Feature(6)598..636
Misc Feature(7)order(817..822,883..888)
Misc Feature(8)1111..1518
Exon (1)1..145
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (2)146..330
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (3)331..513
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (4)514..631
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (5)632..865
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (6)866..1108
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (7)1109..1226
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (8)1227..1445
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (9)1446..1604
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Translation MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQ GCQIRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLV DWITLAHDHYTIAVRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSS IGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGH YDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAY PCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVYHYQFKIQF INQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKW ENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQRMTFCSENTDDLLLRPTQ EKIFVKCEIKSKTSKRKIR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
35+c, tdbSNP:370723304
42+c, tdbSNP:374467536
43+a, gdbSNP:372805598
53+a, gdbSNP:372381397
74+c, tdbSNP:139328592
110+a, tdbSNP:201654179
119+c, gdbSNP:369107346
124+c, tdbSNP:145398861
177+dbSNP:
177+a, gdbSNP:150009389
190+c, tdbSNP:374220111
200+g, tdbSNP:145223292
206+c, tdbSNP:201591235
223+a, gdbSNP:376746632
250+c, tdbSNP:369262181
253+a, gdbSNP:140029729
263+c, tdbSNP:143550925
264+a, gdbSNP:200127425
270+a, gdbSNP:113174258
279+c, gdbSNP:372176025
282+c, tdbSNP:146362585
290+a, gdbSNP:201177069
295..296+, cdbSNP:35493227
321+c, tdbSNP:7175412
322+a, gdbSNP:375761862
330+a, gdbSNP:143786281
340+dbSNP:
340+a, gdbSNP:6078
372+c, tdbSNP:151259669
373+a, gdbSNP:141018530
374+c, tdbSNP:182603751
390+a, gdbSNP:113496365
405+c, tdbSNP:368306971
439+a, gdbSNP:267604272
451..452+, tdbSNP:35834500
453+c, tdbSNP:367826157
460+c, tdbSNP:201014789
461+a, gdbSNP:372054789
469+c, tdbSNP:200324727
470+a, gdbSNP:376854598
490+a, gdbSNP:201563586
491+c, tdbSNP:376664736
492+a, gdbSNP:137974778
501+c, tdbSNP:369832415
502+c, tdbSNP:371009852
503+a, gdbSNP:373392911
522+dbSNP:
522+g, tdbSNP:690
530+c, gdbSNP:142833050
532+c, tdbSNP:376354109
533+a, gdbSNP:145742763
537+c, tdbSNP:370340255
551+c, tdbSNP:375115836
554+c, gdbSNP:368130353
560+g, tdbSNP:200722587
566+a, gdbSNP:200758590
593+a, gdbSNP:369742319
601+a, gdbSNP:188353743
608+c, tdbSNP:138967170
611+a, gdbSNP:375429385
625+a, gdbSNP:368820559
642+dbSNP:
642+c, tdbSNP:149322349
644+c, tdbSNP:374328131
645+a, gdbSNP:34351746
648+a, gdbSNP:6082
675+a, cdbSNP:199615899
680+a, gdbSNP:200684324
701+a, gdbSNP:6083
709+c, gdbSNP:199772942
729+c, gdbSNP:6084
772+a, gdbSNP:199787635
796+a, gdbSNP:371573112
855+c, tdbSNP:376170453
858+c, tdbSNP:201695953
872+dbSNP:
872+c, tdbSNP:148453176
873+c, gdbSNP:371853675
894+c, tdbSNP:146299102
899+a, gdbSNP:200613217
909+c, tdbSNP:139784245
918+c, tdbSNP:369378374
923+c, tdbSNP:121912502
960+a, gdbSNP:199867464
983+g, tdbSNP:61731970
1016+g, tdbSNP:372172193
1036+c, tdbSNP:376388170
1038+c, tdbSNP:142741286
1042+c, tdbSNP:369706830
1043+a, gdbSNP:149195239
1052+a, cdbSNP:372675212
1054+a, cdbSNP:142388191
1055+a, gdbSNP:200889722
1067+a, gdbSNP:372817422
1076+a, tdbSNP:147595392
1079+c, tdbSNP:142050387
1081+a, gdbSNP:145811475
1088+a, gdbSNP:372553692
1116+dbSNP:
1116+c, tdbSNP:138660842
1121+a, gdbSNP:140272400
complement(1125)-t, gdbSNP:3829462
complement(1155)-t, cdbSNP:3829461
1186+c, tdbSNP:202150291
1205+c, tdbSNP:202215798
1219+a, gdbSNP:192572649
1224+c, tdbSNP:149516363
1227+dbSNP:
1227+a, gdbSNP:375751743
1271+c, tdbSNP:113298164
1279+a, gdbSNP:199654215
1281+a, gdbSNP:138902388
1283+a, cdbSNP:142036980
1290+c, tdbSNP:79985029
1346+c, gdbSNP:148510360
1353+a, gdbSNP:115544443
1371+a, gdbSNP:75983069
1372+a, tdbSNP:373806357
1376+a, gdbSNP:6079
1385+c, tdbSNP:144856280
1386+a, gdbSNP:199953853
1388+a, gdbSNP:376117349
1398+c, tdbSNP:200353965
1402+a, gdbSNP:112322348
1413+a, gdbSNP:187073350
1428..1429+, gdbSNP:34282724
1458+dbSNP:
1458+a, tdbSNP:374799133
1471+a, gdbSNP:147928190
1472+a, tdbSNP:34596532
1473+c, tdbSNP:144311843
1482+a, gdbSNP:368077176
1486+c, tdbSNP:147787771
1487+a, gdbSNP:148828229
1494+a, cdbSNP:6074
1509+c, tdbSNP:368480899
1510+a, gdbSNP:375455752
1543+c, tdbSNP:371396620
1576+c, tdbSNP:201548173
1593+a, tdbSNP:374595627
Gene SymbolLIPC
Gene SynonymHDLCQ12; HL; HTGL; LIPH
Chromosome15
Locus Map15q21-q23
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000236 Homo sapiens lipase, hepatic (LIPC), mRNA. On-demand $699.00 18
XM_005254372 PREDICTED: Homo sapiens lipase, hepatic (LIPC), transcript variant X1, mRNA. On-demand $699.00 18
XM_006720501 PREDICTED: Homo sapiens lipase, hepatic (LIPC), transcript variant X4, mRNA. On-demand $699.00 18
XM_005254374 PREDICTED: Homo sapiens lipase, hepatic (LIPC), transcript variant X3, mRNA. On-demand $699.00 18
XM_006720502 PREDICTED: Homo sapiens lipase, hepatic (LIPC), transcript variant X5, mRNA. On-demand $699.00 18
Title Role of SN1 lipases on plasma lipids in metabolic syndrome and obesity .
Author Miksztowicz V, Schreier L, McCoy M, Lucero D, Fassio E, Billheimer J, Rader DJ and Berg G.
Journal Arterioscler. Thromb. Vasc. Biol. 34 (3), 669-675 (2014)
Title Discovery and refinement of loci associated with lipid levels .
Author Willer CJ, Schmidt EM, Sengupta S, Peloso GM, Gustafsson S, Kanoni S, Ganna A, Chen J, Buchkovich ML, Mora S, Beckmann JS, Bragg-Gresham JL, Chang HY, Demirkan A, Den Hertog HM, Do R, Donnelly LA, Ehret GB, Esko T, Feitosa MF, Ferreira T, Fischer K, Fontanillas P, Fraser RM, Freitag DF, Gurdasani D, Heikkila K, Hypponen E, Isaacs A, Jackson AU, Johansson A, Johnson T, Kaakinen M, Kettunen J, Kleber ME, Li X, Luan J, Lyytikainen LP, Magnusson PK, Mangino M, Mihailov E, Montasser ME, Muller-Nurasyid M, Nolte IM, O'Connell JR, Palmer CD, Perola M, Petersen AK, Sanna S, Saxena R, Service SK, Shah S, Shungin D, Sidore C, Song C, Strawbridge RJ, Surakka I, Tanaka T, Teslovich TM, Thorleifsson G, Van den Herik EG, Voight BF, Volcik KA, Waite LL, Wong A, Wu Y, Zhang W, Absher D, Asiki G, Barroso I, Been LF, Bolton JL, Bonnycastle LL, Brambilla P, Burnett MS, Cesana G, Dimitriou M, Doney AS, Doring A, Elliott P, Epstein SE, Eyjolfsson GI, Gigante B, Goodarzi MO, Grallert H, Gravito ML, Groves CJ, Hallmans G, Hartikainen AL, Hayward C, Hernandez D, Hicks AA, Holm H, Hung YJ, Illig T, Jones MR, Kaleebu P, Kastelein JJ, Khaw KT, Kim E, Klopp N, Komulainen P, Kumari M, Langenberg C, Lehtimaki T, Lin SY, Lindstrom J, Loos RJ, Mach F, McArdle WL, Meisinger C, Mitchell BD, Muller G, Nagaraja R, Narisu N, Nieminen TV, Nsubuga RN, Olafsson I, Ong KK, Palotie A, Papamarkou T, Pomilla C, Pouta A, Rader DJ, Reilly MP, Ridker PM, Rivadeneira F, Rudan I, Ruokonen A, Samani N, Scharnagl H, Seeley J, Silander K, Stancakova A, Stirrups K, Swift AJ, Tiret L, Uitterlinden AG, van Pelt LJ, Vedantam S, Wainwright N, Wijmenga C, Wild SH, Willemsen G, Wilsgaard T, Wilson JF, Young EH, Zhao JH, Adair LS, Arveiler D, Assimes TL, Bandinelli S, Bennett F, Bochud M, Boehm BO, Boomsma DI, Borecki IB, Bornstein SR, Bovet P, Burnier M, Campbell H, Chakravarti A, Chambers JC, Chen YD, Collins FS, Cooper RS, Danesh J, Dedoussis G, de Faire U, Feranil AB, Ferrieres J, Ferrucci L, Freimer NB, Gieger C, Groop LC, Gudnason V, Gyllensten U, Hamsten A, Harris TB, Hingorani A, Hirschhorn JN, Hofman A, Hovingh GK, Hsiung CA, Humphries SE, Hunt SC, Hveem K, Iribarren C, Jarvelin MR, Jula A, Kahonen M, Kaprio J, Kesaniemi A, Kivimaki M, Kooner JS, Koudstaal PJ, Krauss RM, Kuh D, Kuusisto J, Kyvik KO, Laakso M, Lakka TA, Lind L, Lindgren CM, Martin NG, Marz W, McCarthy MI, McKenzie CA, Meneton P, Metspalu A, Moilanen L, Morris AD, Munroe PB, Njolstad I, Pedersen NL, Power C, Pramstaller PP, Price JF, Psaty BM, Quertermous T, Rauramaa R, Saleheen D, Salomaa V, Sanghera DK, Saramies J, Schwarz PE, Sheu WH, Shuldiner AR, Siegbahn A, Spector TD, Stefansson K, Strachan DP, Tayo BO, Tremoli E, Tuomilehto J, Uusitupa M, van Duijn CM, Vollenweider P, Wallentin L, Wareham NJ, Whitfield JB, Wolffenbuttel BH, Ordovas JM, Boerwinkle E, Palmer CN, Thorsteinsdottir U, Chasman DI, Rotter JI, Franks PW, Ripatti S, Cupples LA, Sandhu MS, Rich SS, Boehnke M, Deloukas P, Kathiresan S, Mohlke KL, Ingelsson E and Abecasis GR.
Journal Nat. Genet. 45 (11), 1274-1283 (2013)
Title Genetic association with lipids in Filipinos: waist circumference modifies an APOA5 effect on triglyceride levels .
Author Wu Y, Marvelle AF, Li J, Croteau-Chonka DC, Feranil AB, Kuzawa CW, Li Y, Adair LS and Mohlke KL.
Journal J. Lipid Res. 54 (11), 3198-3205 (2013)
Title Comparative analyses of lipoprotein lipase, hepatic lipase, and endothelial lipase, and their binding properties with known inhibitors .
Author Wang Z, Li S, Sun L, Fan J and Liu Z.
Journal PLoS ONE 8 (8), E72146 (2013)
Title Association of hepatic lipase -514T allele with coronary artery disease and ankle-brachial index, dependence on the lipoprotein phenotype: the GENES study .
Author Verdier C, Ruidavets JB, Bongard V, Taraszkiewicz D, Martinez LO, Elbaz M, Ferrieres J and Perret B.
Journal PLoS ONE 8 (7), E67805 (2013)
Title Human hepatic lipase mutations and polymorphisms .
Author Hegele RA, Tu L and Connelly PW.
Journal Hum. Mutat. 1 (4), 320-324 (1992)
Title Compound heterozygosity for mutant hepatic lipase in familial hepatic lipase deficiency .
Author Hegele RA, Little JA and Connelly PW.
Journal Biochem. Biophys. Res. Commun. 179 (1), 78-84 (1991)
Title A hepatic lipase gene mutation associated with heritable lipolytic deficiency .
Author Hegele RA, Vezina C, Moorjani S, Lupien PJ, Gagne C, Brun LD, Little JA and Connelly PW.
Journal J. Clin. Endocrinol. Metab. 72 (3), 730-732 (1991)
Title Isolation and characterization of the human hepatic lipase gene .
Author Ameis D, Stahnke G, Kobayashi J, McLean J, Lee G, Buscher M, Schotz
Journal J. Biol. Chem. 265 (12), 6552-6555 (1990)
Title Effect of serum and C-apoproteins from very low density lipoproteins on human postheparin plasma hepatic lipase .
Author Kinnunen,P.K. and Ehnolm,C.
Journal FEBS Lett. 65 (3), 354-357 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.