• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens lipase, hepatic (LIPC), mRNA.


RefSeq Accession Definition Services Price Order
NM_000236 Homo sapiens lipase, hepatic (LIPC), mRNA. ORF Sequence $435.00
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000236.2, 194097334
Length 1614 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens lipase, hepatic (LIPC), mRNA.
Product hepatic triacylglycerol lipase precursor
Comment

Summary: LIPC encodes hepatic triglyceride lipase, which is expressed in liver. LIPC has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. [provided by RefSeq, Jul 2008].

RefSeq NP_000227.2
CDS 58..1557
Misc Feature(1)46..48
Misc Feature(2)202..1092
Misc Feature(3)241..1548
Misc Feature(4)553..567
Misc Feature(5)order(559..561,637..639,892..894)
Misc Feature(6)598..636
Misc Feature(7)order(817..822,883..888)
Misc Feature(8)1111..1518
Exon (1)1..145
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (2)146..330
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (3)331..513
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (4)514..631
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (5)632..865
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (6)866..1108
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (7)1109..1226
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (8)1227..1445
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Exon (9)1446..1604
Gene:LIPC
Gene Synonym:HDLCQ12; HL; HTGL; LIPH
Translation MDTSPLCFSILLVLCIFIQSSALGQSLKPEPFGRRAQAVETNKTLHEMKTRFLLFGETNQ GCQIRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQPAQPVNVGLV DWITLAHDHYTIAVRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGFAGSS IGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGH YDFYPNGGSFQPGCHFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSMAY PCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPFKVYHYQFKIQF INQTETPIQTTFTMSLLGTKEKMQKIPITLGKGIASNKTYSFLITLDVDIGELIMIKFKW ENSAVWANVWDTVQTIIPWSTGPRHSGLVLKTIRVKAGETQQRMTFCSENTDDLLLRPTQ EKIFVKCEIKSKTSKRKIR
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
74+c, tdbSNP:139328592
110+a, tdbSNP:201654179
124+c, tdbSNP:145398861
177+dbSNP:
177+a, gdbSNP:150009389
200+g, tdbSNP:145223292
206+c, tdbSNP:201591235
253+a, gdbSNP:140029729
263+c, tdbSNP:143550925
264+a, gdbSNP:200127425
270+a, gdbSNP:113174258
282+c, tdbSNP:146362585
290+a, gdbSNP:201177069
293..294+, cdbSNP:35493227
321+c, tdbSNP:7175412
330+a, gdbSNP:143786281
340+dbSNP:
340+a, gdbSNP:6078
372+c, tdbSNP:151259669
373+a, gdbSNP:141018530
374+c, tdbSNP:182603751
390+a, gdbSNP:113496365
451..452+, tdbSNP:35834500
460+c, tdbSNP:201014789
469+c, tdbSNP:200324727
490+a, gdbSNP:201563586
492+a, gdbSNP:137974778
522+dbSNP:
522+g, tdbSNP:690
530+c, gdbSNP:142833050
533+a, gdbSNP:145742763
560+g, tdbSNP:200722587
566+a, gdbSNP:200758590
601+a, gdbSNP:188353743
608+c, tdbSNP:138967170
642+dbSNP:
642+c, tdbSNP:149322349
645+a, gdbSNP:34351746
648+a, gdbSNP:6082
675+a, cdbSNP:199615899
680+a, gdbSNP:200684324
701+a, gdbSNP:6083
709+c, gdbSNP:199772942
729+c, gdbSNP:6084
772+a, gdbSNP:199787635
813+c, tdbSNP:140062100
858+c, tdbSNP:201695953
872+dbSNP:
872+c, tdbSNP:148453176
894+c, tdbSNP:146299102
899+a, gdbSNP:200613217
909+c, tdbSNP:139784245
923+c, tdbSNP:121912502
960+a, gdbSNP:199867464
983+g, tdbSNP:61731970
1038+c, tdbSNP:142741286
1043+a, gdbSNP:149195239
1054+a, cdbSNP:142388191
1055+a, gdbSNP:200889722
1076+a, tdbSNP:147595392
1079+c, tdbSNP:142050387
1081+a, gdbSNP:145811475
1116+dbSNP:
1116+c, tdbSNP:138660842
1121+a, gdbSNP:140272400
1125+g, tdbSNP:3829462
1155+c, tdbSNP:3829461
1186+c, tdbSNP:202150291
1205+c, tdbSNP:202215798
1219+a, gdbSNP:192572649
1224+c, tdbSNP:149516363
1271+dbSNP:
1271+c, tdbSNP:113298164
1279+a, gdbSNP:199654215
1281+a, gdbSNP:138902388
1283+a, cdbSNP:142036980
1290+c, tdbSNP:79985029
1346+c, gdbSNP:148510360
1353+a, gdbSNP:115544443
1371+a, gdbSNP:75983069
1376+a, gdbSNP:6079
1385+c, tdbSNP:144856280
1386+a, gdbSNP:199953853
1398+c, tdbSNP:200353965
1402+a, gdbSNP:112322348
1413+a, gdbSNP:187073350
1428..1429+, gdbSNP:34282724
1471+dbSNP:
1471+a, gdbSNP:147928190
1472+a, tdbSNP:34596532
1473+c, tdbSNP:144311843
1486+c, tdbSNP:147787771
1487+a, gdbSNP:148828229
1494+a, cdbSNP:6074
1576+c, tdbSNP:201548173
Gene SymbolLIPC
Gene SynonymHDLCQ12; HL; HTGL; LIPH
Chromosome15
Locus Map15q21-q23
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000236 Homo sapiens lipase, hepatic (LIPC), mRNA. Full Length $468.06
ORF Sequence $435.00
Title A high-carbohydrate diet effects on the A allele of hepatic lipase polymorphism on the apoB100/apoAI ratio in young Chinese males .
Author Hu,M., Li,Z. and Fang,D.Z.
Journal Adv Clin Exp Med 21 (6), 751-757 (2012)
Title A high carbohydrate diet induces the beneficial effect of the CC genotype of hepatic lipase C-514T polymorphism on the apoB100/apoAI ratio only in young Chinese males .
Author Hu,M., Li,Z. and Fang,D.Z.
Journal Scand. J. Clin. Lab. Invest. 72 (7), 563-569 (2012)
Title Resequencing CETP, LIPC and LIPG genes in Thai subjects with hyperalphalipoproteinemia .
Author Khovidhunkit,W., Chartyingcharoen,P., Siriwong,S., Limumpornpetch,P. and Plengpanich,W.
Journal Am. J. Cardiol. 110 (1), 62-66 (2012)
Title Genome-wide screen for metabolic syndrome susceptibility Loci reveals strong lipid gene contribution but no evidence for common genetic basis for clustering of metabolic syndrome traits .
Author Kristiansson,K., Perola,M., Tikkanen,E., Kettunen,J., Surakka,I., Havulinna,A.S., Stancakova,A., Barnes,C., Widen,E., Kajantie,E., Eriksson,J.G., Viikari,J., Kahonen,M., Lehtimaki,T., Raitakari,O.T., Hartikainen,A.L., Ruokonen,A., Pouta,A., Jula,A., Kangas,A.J., Soininen,P., Ala-Korpela,M., Mannisto,S., Jousilahti,P., Bonnycastle,L.L., Jarvelin,M.R., Kuusisto,J., Collins,F.S., Laakso,M., Hurles,M.E., Palotie,A., Peltonen,L., Ripatti,S. and Salomaa,V.
Journal Circ Cardiovasc Genet 5 (2), 242-249 (2012)
Title Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis .
Author Inouye,M., Ripatti,S., Kettunen,J., Lyytikainen,L.P., Oksala,N., Laurila,P.P., Kangas,A.J., Soininen,P., Savolainen,M.J., Viikari,J., Kahonen,M., Perola,M., Salomaa,V., Raitakari,O., Lehtimaki,T., Taskinen,M.R., Jarvelin,M.R., Ala-Korpela,M., Palotie,A. and de Bakker,P.I.
Journal PLoS Genet. 8 (8), E1002907 (2012)
Title Human hepatic lipase mutations and polymorphisms .
Author Hegele,R.A., Tu,L. and Connelly,P.W.
Journal Hum. Mutat. 1 (4), 320-324 (1992)
Title Compound heterozygosity for mutant hepatic lipase in familial hepatic lipase deficiency .
Author Hegele,R.A., Little,J.A. and Connelly,P.W.
Journal Biochem. Biophys. Res. Commun. 179 (1), 78-84 (1991)
Title A hepatic lipase gene mutation associated with heritable lipolytic deficiency .
Author Hegele,R.A., Vezina,C., Moorjani,S., Lupien,P.J., Gagne,C., Brun,L.D., Little,J.A. and Connelly,P.W.
Journal J. Clin. Endocrinol. Metab. 72 (3), 730-732 (1991)
Title Isolation and characterization of the human hepatic lipase gene .
Author Ameis,D., Stahnke,G., Kobayashi,J., McLean,J., Lee,G., Buscher,M., Schotz,M.C. and Will,H.
Journal J. Biol. Chem. 265 (12), 6552-6555 (1990)
Title Effect of serum and C-apoproteins from very low density lipoproteins on human postheparin plasma hepatic lipase .
Author Kinnunen,P.K. and Ehnolm,C.
Journal FEBS Lett. 65 (3), 354-357 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878