Sequence in raw or FASTA format:
Homo sapiens monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, mRNA.
| RefSeq Version | NM_000240.2, 33469954 |
| Length | 4090 bp |
| Structure | linear |
| Update Date | 24-APR-2011 |
| Organism | Homo sapiens (human) |
| Definition | Homo sapiens monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, mRNA. |
| Product | amine oxidase [flavin-containing] A |
| Comment | Summary: This gene encodes monoamine oxidase A, an enzyme that degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the mitochondrial outer membrane. The gene is adjacent to a related gene on the opposite strand of chromosome X. Mutation in this gene results in monoamine oxidase deficiency, or Brunner syndrome. [provided by RefSeq]. |
| RefSeq | NP_000231.1 |
| CDS | 182..1765 | Exon (1) | 1..254 | Exon (2) | 1..254 | Exon (3) | 255..349 | Exon (4) | 350..487 | Exon (5) | 488..592 | Exon (6) | 593..684 | Exon (7) | 685..826 | Exon (8) | 827..976 | Exon (9) | 977..1136 | Exon (10) | 1137..1233 | Exon (11) | 1234..1287 | Exon (12) | 1288..1345 | Exon (13) | 1346..1443 | Exon (14) | 1444..1555 | Exon (15) | 1556..1618 | Exon (16) | 1619..4073 |
| Translation | MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here. |
| Position | Chain | Variation | Link |
| 566 | + | a, c | dbSNP:1800464 |
| 696 | + | a, g | dbSNP:58524323 |
| 743 | + | a, g | dbSNP:77698881 |
| 818 | + | g, t | dbSNP:1137068 |
| 1067 | + | c, t | dbSNP:72554632 |
| 1072 | + | g, t | dbSNP:6323 |
| 1074 | + | c, t | dbSNP:61730725 |
| 1121 | + | g, t | dbSNP:1799835 |
| 1207 | + | a, t | dbSNP:1800465 |
| complement(1222) | - | t, a | dbSNP:78609544 |
| 1342 | + | a, g | dbSNP:7065428 |
| 1516 | + | g, t | dbSNP:1803986 |
| 1591 | + | c, t | dbSNP:1137070 |
| 1740 | + | a, g | dbSNP:1800466 |
| 2846 | + | a, g | dbSNP:3027407 |
| complement(2923) | - | t, c | dbSNP:11544798 |
| 3226 | + | a, g | dbSNP:3027408 |
| Title | Cumulative-genetic plasticity, parenting and adolescent self-regulation . |
| Author | Belsky,J. and Beaver,K.M. |
| Journal | J Child Psychol Psychiatry 52 (5), 619-626 (2011) |
| Title | MAO A VNTR polymorphism and amygdala volume in healthy subjects . |
| Author | Cerasa,A., Quattrone,A., Gioia,M.C., Magariello,A., Muglia,M., Assogna,F., Bernardini,S., Caltagirone,C., Bossu,P. and Spalletta,G. |
| Journal | Psychiatry Res 191 (2), 87-91 (2011) |
| Title | Bimodal distribution of RNA expression levels in human skeletal muscle tissue . |
| Author | Mason,C.C., Hanson,R.L., Ossowski,V., Bian,L., Baier,L.J., Krakoff,J. and Bogardus,C. |
| Journal | BMC Genomics 12, 98 (2011) |
| Title | MAO-A promoter polymorphism and idiopathic pulmonary arterial hypertension . |
| Author | Vadapalli,S., Katta,S., Sastry,B.K. and Nallari,P. |
| Journal | J. Genet. 89 (4), E43-E45 (2010) |
| Title | Aggression, Digit Ratio and Variation in Androgen Receptor and Monoamine Oxidase A Genes in Men . |
| Author | Hurd,P.L., Vaillancourt,K.L. and Dinsdale,N.L. |
| Journal | Behav. Genet. (2010) In press |
| Title | Promoter organization and activity of human monoamine oxidase (MAO) . |
| Author | Zhu,Q.S., Grimsby,J., Chen,K. and Shih,J.C. |
| Journal | J. Neurosci. 12 (11), 4437-4446 (1992) |
| Title | Quantitative enzyme radioautography with 3H-Ro 41-1049 and 3H-Ro 19-6327 in vitro: localization and abundance of MAO-A and MAO-B in rat CNS, peripheral organs, and human brain . |
| Author | Saura,J., Kettler,R., Da Prada,M. and Richards,J.G. |
| Journal | J. Neurosci. 12 (5), 1977-1999 (1992) |
| Title | Mode of action and characteristics of monoamine oxidase-A inhibition by moclobemide . |
| Author | Cesura,A.M., Kettler,R., Imhof,R. and Da Prada,M. |
| Journal | Psychopharmacology (Berl.) 106 SUPPL, S15-S16 (1992) |
| Title | Genetic and physical mapping around the properdin P gene . |
| Author | Coleman,M.P., Murray,J.C., Willard,H.F., Nolan,K.F., Reid,K.B., Blake,D.J., Lindsay,S., Bhattacharya,S.S., Wright,A. and Davies,K.E. |
| Journal | Genomics 11 (4), 991-996 (1991) |
| Title | Structure of the human gene for monoamine oxidase type A . |
| Author | Chen,Z.Y., Hotamisligil,G.S., Huang,J.K., Wen,L., Ezzeddine,D., Aydin-Muderrisoglu,N., Powell,J.F., Huang,R.H., Breakefield,X.O., Craig,I. et al. |
| Journal | Nucleic Acids Res. 19 (16), 4537-4541 (1991) |
Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.
 |
Secured Online Quotation |
 |
Email: gene@genscript.com |
 |
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188 |
 |
Fax: 1-732-210-0262 1-732-885-5878 |