• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_000240 Homo sapiens monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, transcript variant 1, mRNA. ORF Sequence $459.36
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000240.3, 395132502
Length 5330 bp
Structure linear
Update Date 29-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, transcript variant 1, mRNA.
Product amine oxidase [flavin-containing] A isoform 1
Comment

Summary: This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012].


Transcript Variant: This variant (1) encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000231.1
CDS 1436..3019
Misc Feature(1)902..904
Misc Feature(2)1436..1438
Misc Feature(3)1436..1438
Misc Feature(4)1505..2770
Misc Feature(5)1505..>1609
Misc Feature(6)2438..2440
Misc Feature(7)2555..2557
Misc Feature(8)2651..2653
Misc Feature(9)2927..2989
Misc Feature(10)2993..3001
Exon (1)1..1508
Gene:MAOA
Gene Synonym:MAO-A
Exon (2)1509..1603
Gene:MAOA
Gene Synonym:MAO-A
Exon (3)1604..1741
Gene:MAOA
Gene Synonym:MAO-A
Exon (4)1742..1846
Gene:MAOA
Gene Synonym:MAO-A
Exon (5)1847..1938
Gene:MAOA
Gene Synonym:MAO-A
Exon (6)1939..2080
Gene:MAOA
Gene Synonym:MAO-A
Exon (7)2081..2230
Gene:MAOA
Gene Synonym:MAO-A
Exon (8)2231..2390
Gene:MAOA
Gene Synonym:MAO-A
Exon (9)2391..2487
Gene:MAOA
Gene Synonym:MAO-A
Exon (10)2488..2541
Gene:MAOA
Gene Synonym:MAO-A
Exon (11)2542..2599
Gene:MAOA
Gene Synonym:MAO-A
Exon (12)2600..2697
Gene:MAOA
Gene Synonym:MAO-A
Exon (13)2698..2809
Gene:MAOA
Gene Synonym:MAO-A
Exon (14)2810..2872
Gene:MAOA
Gene Synonym:MAO-A
Exon (15)2873..5330
Gene:MAOA
Gene Synonym:MAO-A
Translation MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
234+a, gdbSNP:112651393
265..276+, gcaccagtacccdbSNP:199760605
282..283+, agtaccggcaccggcaccdbSNP:71980227
294+a, gdbSNP:113552192
702+g, tdbSNP:182564399
859+a, gdbSNP:17436054
1191+a, gdbSNP:187223433
1362+c, tdbSNP:192549444
1572+dbSNP:
1572+a, gdbSNP:201519600
1621+dbSNP:
1621+c, tdbSNP:180855715
1760+dbSNP:
1760+c, tdbSNP:140295792
1809+a, gdbSNP:201799429
1820+a, cdbSNP:1800464
1872+dbSNP:
1872+c, tdbSNP:199524208
1950+dbSNP:
1950+a, gdbSNP:58524323
1997+a, gdbSNP:77698881
2000+g, tdbSNP:142659522
2072+g, tdbSNP:1137068
2117+a, gdbSNP:201785423
2240+dbSNP:
2240+a, gdbSNP:150176511
2260+a, gdbSNP:138703731
2321+c, tdbSNP:72554632
2326+g, tdbSNP:6323
2328+c, tdbSNP:61730725
2368+g, tdbSNP:144688481
2375+g, tdbSNP:1799835
2461+dbSNP:
2461+a, tdbSNP:1800465
2476+a, g, tdbSNP:78609544
2554+dbSNP:
2554+a, cdbSNP:200913136
2563+c, gdbSNP:139933657
2596+a, gdbSNP:7065428
2770+dbSNP:
2770+g, tdbSNP:1803986
2845+c, tdbSNP:1137070
2876+dbSNP:
2876+a, gdbSNP:183147374
2961+c, tdbSNP:147298607
2984+a, gdbSNP:140960519
2994+a, gdbSNP:1800466
3063+c, tdbSNP:186269028
3438+c, tdbSNP:144369167
3553+g, tdbSNP:148377725
3626+a, tdbSNP:141507018
3843+c, tdbSNP:190345937
3902+c, tdbSNP:183633096
3988+a, gdbSNP:188559810
4062+c, tdbSNP:192869160
4100+a, gdbSNP:3027407
4177+c, tdbSNP:11544798
4262+c, tdbSNP:183135924
4302+a, gdbSNP:140387504
4480+a, gdbSNP:3027408
4699+c, tdbSNP:186651981
4931+a, gdbSNP:191501890
4995+a, tdbSNP:184725808
5238+a, tdbSNP:189494708
Gene SymbolMAOA
Gene SynonymMAO-A
ChromosomeX
Locus MapXp11.3
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000240 Homo sapiens monoamine oxidase A (MAOA), nuclear gene encoding mitochondrial protein, transcript variant 1, mRNA. Full Length $2398.50
ORF Sequence $459.36
NM_001270458 Homo sapiens monoamine oxidase A (MAOA), transcript variant 2, mRNA. Full Length $2447.10
ORF Sequence $343.65
Title Association study between the dopamine-related candidate gene polymorphisms and ADHD among Saudi Arabia population via PCR technique .
Author El-Tarras,A.E., Alsulaimani,A.A., Awad,N.S., Mitwaly,N., Said,M.M. and Sabry,A.M.
Journal Mol. Biol. Rep. 39 (12), 11081-11086 (2012)
Title MAOA promoter methylation and susceptibility to carotid atherosclerosis: role of familial factors in a monozygotic twin sample .
Author Zhao,J., Forsberg,C.W., Goldberg,J., Smith,N.L. and Vaccarino,V.
Journal BMC Med. Genet. 13, 100 (2012)
Title Serotonin, genetic variability, behaviour, and psychiatric disorders--a review .
Author Nordquist,N. and Oreland,L.
Journal Ups. J. Med. Sci. 115 (1), 2-10 (2010)
Title Abnormal behavior associated with a point mutation in the structural gene for monoamine oxidase A .
Author Brunner,H.G., Nelen,M., Breakefield,X.O., Ropers,H.H. and van Oost,B.A.
Journal Science 262 (5133), 578-580 (1993)
Title Promoter organization and activity of human monoamine oxidase (MAO) .
Author Zhu,Q.S., Grimsby,J., Chen,K. and Shih,J.C.
Journal J. Neurosci. 12 (11), 4437-4446 (1992)
Title Structure of the human gene for monoamine oxidase type A .
Author Chen,Z.Y., Hotamisligil,G.S., Huang,J.K., Wen,L., Ezzeddine,D., Aydin-Muderrisoglu,N., Powell,J.F., Huang,R.H., Breakefield,X.O., Craig,I. et al.
Journal Nucleic Acids Res. 19 (16), 4537-4541 (1991)
Title Human monoamine oxidase A and B genes exhibit identical exon-intron organization .
Author Grimsby,J., Chen,K., Wang,L.J., Lan,N.C. and Shih,J.C.
Journal Proc. Natl. Acad. Sci. U.S.A. 88 (9), 3637-3641 (1991)
Title Structural features of human monoamine oxidase A elucidated from cDNA and peptide sequences .
Author Hsu,Y.P., Weyler,W., Chen,S., Sims,K.B., Rinehart,W.B., Utterback,M.C., Powell,J.F. and Breakefield,X.O.
Journal J. Neurochem. 51 (4), 1321-1324 (1988)
Title cDNA cloning of human liver monoamine oxidase A and B: molecular basis of differences in enzymatic properties .
Author Bach,A.W., Lan,N.C., Johnson,D.L., Abell,C.W., Bembenek,M.E., Kwan,S.W., Seeburg,P.H. and Shih,J.C.
Journal Proc. Natl. Acad. Sci. U.S.A. 85 (13), 4934-4938 (1988)
Title Human monoamine oxidase gene (MAOA): chromosome position (Xp21-p11) and DNA polymorphism .
Author Ozelius,L., Hsu,Y.P., Bruns,G., Powell,J.F., Chen,S., Weyler,W., Utterback,M., Zucker,D., Haines,J., Trofatter,J.A. et al.
Journal Genomics 3 (1), 53-58 (1988)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878