• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens mannose-binding lectin (protein C) 2, soluble (MBL2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu19370 Homo sapiens mannose-binding lectin (protein C) 2, soluble (MBL2), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu19370C Homo sapiens mannose-binding lectin (protein C) 2, soluble (MBL2), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000242.2, 171906615
Length 747 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens mannose-binding lectin (protein C) 2, soluble (MBL2), mRNA.
Product mannose-binding protein C precursor
Comment

Summary: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [provided by RefSeq, Jul 2008].


Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.

RefSeq NP_000233.1
CDS 66..812
Misc Feature(1)18..20
Misc Feature(2)204..206
Misc Feature(3)282..284
Misc Feature(4)300..302
Misc Feature(5)309..311
Misc Feature(6)327..329
Misc Feature(7)471..803
Misc Feature(8)order(627..629,639..641,708..710,723..728)
Misc Feature(9)order(639..641,708..710,726..728)
Misc Feature(10)order(699..701,705..707,723..725,759..764)
Exon (1)1..252
Gene:MBL2
Gene Synonym:COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD
Exon (2)253..369
Gene:MBL2
Gene Synonym:COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD
Exon (3)370..438
Gene:MBL2
Gene Synonym:COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD
Exon (4)439..3569
Gene:MBL2
Gene Synonym:COLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD
Translation MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH LAVCEFPI
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(22)-t, cdbSNP:4647963
complement(39)-c, adbSNP:376929554
complement(52)-g, cdbSNP:184683428
complement(60)-t, cdbSNP:376862775
complement(61)-t, cdbSNP:370642219
complement(67)-g, adbSNP:139669290
complement(72)-g, adbSNP:141739326
complement(87)-g, adbSNP:150611863
99+c, gdbSNP:72661126
100+g, tdbSNP:72661127
complement(115)-g, adbSNP:76063875
116+a, gdbSNP:56412725
139+c, gdbSNP:72661128
complement(148)-g, adbSNP:372226530
complement(160)-c, adbSNP:199957742
167+a, gdbSNP:8179079
complement(174)-c, adbSNP:201511397
complement(181)-t, cdbSNP:146004726
complement(182)-g, adbSNP:142532058
complement(183)-c, adbSNP:148483303
complement(197)-g, adbSNP:34120190
219+c, tdbSNP:5030737
complement(220)-t, cdbSNP:148078249
226+a, gdbSNP:1800450
complement(226)-t, cdbSNP:386545582
complement(253)-dbSNP:
complement(253)-c, adbSNP:374041970
complement(259)-t, g, cdbSNP:201305883
complement(277)-, cdbSNP:377568440
complement(279)-g, cdbSNP:370571813
complement(349)-g, cdbSNP:368461120
complement(367)-g, adbSNP:143562102
368+a, gdbSNP:55902142
complement(379)-dbSNP:
complement(379)-t, g, cdbSNP:137974936
complement(382)-c, adbSNP:202135976
complement(421)-g, adbSNP:181047707
complement(424)-t, gdbSNP:140526147
complement(426)-g, adbSNP:188107846
complement(427)-t, cdbSNP:200416222
complement(443)-dbSNP:
complement(443)-g, cdbSNP:930507
complement(462)-g, cdbSNP:201337696
complement(465)-t, cdbSNP:200040065
complement(473)-t, cdbSNP:35805975
complement(482)-g, adbSNP:267602524
complement(514)-t, gdbSNP:149216902
complement(515)-t, cdbSNP:146554537
complement(517)-t, gdbSNP:8191995
complement(517)-t, gdbSNP:386616260
complement(555)-t, gdbSNP:200749792
complement(574)-t, cdbSNP:144193243
complement(592)-g, adbSNP:8191996
complement(592)-g, adbSNP:386616261
complement(594)-g, adbSNP:267602523
complement(613)-c, adbSNP:139637221
complement(640)-t, gdbSNP:368165740
complement(670)-g, cdbSNP:375051927
complement(692)-g, adbSNP:370867162
complement(693)-c, adbSNP:74754826
complement(705)-t, adbSNP:12260094
complement(708)-t, cdbSNP:368692351
complement(788)-t, cdbSNP:144103418
complement(791)-t, gdbSNP:139905034
complement(792)-t, cdbSNP:185230071
complement(795)-g, adbSNP:370749963
complement(803)-g, adbSNP:376149426
complement(815)-c, adbSNP:371397104
complement(818)-t, gdbSNP:202025794
complement(846)-g, adbSNP:199798659
complement(954)-g, cdbSNP:193077443
complement(961..962)-, gdbSNP:34180095
complement(1125)-g, adbSNP:146097239
complement(1133)-t, gdbSNP:56196250
complement(1259)-g, cdbSNP:374583038
1487+c, tdbSNP:56213573
complement(1532)-t, cdbSNP:55906813
complement(1570)-t, cdbSNP:189703968
1578+c, tdbSNP:1126881
complement(1589)-g, adbSNP:184873845
complement(1622)-g, adbSNP:142826643
1627+c, gdbSNP:56129213
complement(1630)-g, adbSNP:56311691
1677+a, cdbSNP:55714260
complement(1731)-g, adbSNP:139256308
complement(1864..1865)-, actgdbSNP:368536500
1900+c, tdbSNP:56095345
complement(1903..1904)-, gdbSNP:35648179
complement(1946..1948)-ttg, ctadbSNP:386743749
complement(1946)-g, adbSNP:11003121
complement(1947)-t, cdbSNP:11595876
complement(1948)-t, cdbSNP:115639140
complement(1948)-t, cdbSNP:386453850
complement(2024)-t, gdbSNP:191589143
complement(2087..2088)-g, adbSNP:58830057
complement(2087)-g, adbSNP:10082466
complement(2100)-t, cdbSNP:150837380
complement(2215)-t, cdbSNP:141410154
complement(2257)-g, adbSNP:148385740
complement(2264)-t, adbSNP:186828712
complement(2310)-g, adbSNP:56009657
complement(2315)-, adbSNP:35937235
complement(2347)-t, gdbSNP:182107601
complement(2349)-t, adbSNP:192591672
complement(2503)-t, cdbSNP:10824792
2506+g, tdbSNP:35327474
2507+a, g, tdbSNP:35768126
complement(2523)-c, adbSNP:12254557
complement(2523)-c, adbSNP:386523457
complement(2556)-g, adbSNP:147320014
complement(2669)-t, cdbSNP:2120132
complement(2691)-t, gdbSNP:2120131
complement(2700)-t, adbSNP:375995120
complement(2725)-g, adbSNP:2165813
complement(2852)-c, adbSNP:2099903
complement(2860)-t, cdbSNP:2099902
complement(3019)-t, cdbSNP:191761980
complement(3031)-t, gdbSNP:2083771
complement(3043)-g, adbSNP:377026690
3193+a, cdbSNP:56344844
complement(3200)-c, adbSNP:2506
complement(3260)-c, adbSNP:115323074
complement(3262)-t, adbSNP:56325023
3289+c, tdbSNP:55855374
3312+g, tdbSNP:1042749
3390+c, tdbSNP:56212603
complement(3460)-t, gdbSNP:183826308
complement(3461)-t, cdbSNP:186505323
complement(3496)-c, adbSNP:369533862
complement(3514)-t, cdbSNP:114932753
complement(3521)-t, adbSNP:182548321
complement(3539)-c, adbSNP:138449358
Gene SymbolMBL2
Gene SynonymCOLEC1; HSMBPC; MBL; MBL2D; MBP; MBP-C; MBP1; MBPD
Chromosome10
Locus Map10q11.2
Title Mannan-binding protein, a C-type serum lectin, recognizes primary colorectal carcinomas through tumor-associated Lewis glycans .
Author Nonaka M, Imaeda H, Matsumoto S, Yong Ma B, Kawasaki N, Mekata E, Andoh A, Saito Y, Tani T, Fujiyama Y and Kawasaki T.
Journal J. Immunol. 192 (3), 1294-1301 (2014)
Title MBL2 variations and malaria susceptibility in Indian populations .
Author Jha AN, Sundaravadivel P, Singh VK, Pati SS, Patra PK, Kremsner PG, Velavan TP, Singh L and Thangaraj K.
Journal Infect. Immun. 82 (1), 52-61 (2014)
Title Risk of infection and sepsis in severely injured patients related to single nucleotide polymorphisms in the lectin pathway .
Author Bronkhorst MW, Lomax MA, Vossen RH, Bakker J, Patka P and van Lieshout EM.
Journal Br J Surg 100 (13), 1818-1826 (2013)
Title Mannose-binding lectin deficiency and disease severity in non-cystic fibrosis bronchiectasis: a prospective study .
Author Chalmers JD, McHugh BJ, Doherty C, Smith MP, Govan JR, Kilpatrick
Journal Lancet Respir Med 1 (3), 224-232 (2013)
Title Potential role of mannose-binding lectin in intrauterine transmission of hepatitis B virus .
Author Wu Y, Zhou Q, Wang H, Tian T, Zhu Q, Wang H, Bai X, Yang X, Wang Z and Dong M.
Journal Jpn. J. Infect. Dis. 66 (5), 391-393 (2013)
Title Gene frequency and partial protein characterization of an allelic variant of mannan binding protein associated with low serum concentrations .
Author Garred P, Thiel S, Madsen HO, Ryder LP, Jensenius JC and Svejgaard A.
Journal Clin. Exp. Immunol. 90 (3), 517-521 (1992)
Title High frequencies in African and non-African populations of independent mutations in the mannose binding protein gene .
Author Lipscombe RJ, Sumiya M, Hill AV, Lau YL, Levinsky RJ, Summerfield
Journal Hum. Mol. Genet. 1 (9), 709-715 (1992)
Title Distinct and overlapping functions of allelic forms of human mannose binding protein .
Author Super M, Gillies SD, Foley S, Sastry K, Schweinle JE, Silverman VJ and Ezekowitz RA.
Journal Nat. Genet. 2 (1), 50-55 (1992)
Title Molecular basis of opsonic defect in immunodeficient children .
Author Sumiya M, Super M, Tabona P, Levinsky RJ, Arai T, Turner MW and Summerfield JA.
Journal Lancet 337 (8757), 1569-1570 (1991)
Title The gene for mannose-binding protein maps to chromosome 10 and is a marker for multiple endocrine neoplasia type 2 .
Author Schuffenecker I, Narod SA, Ezekowitz RA, Sobol H, Feunteun J and Lenoir GM.
Journal Cytogenet. Cell Genet. 56 (2), 99-102 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.