• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant 1, mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000254 Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant 1, mRNA. GenEZ ORF Cloning On-demand $1699.00 25

*Business Day

Related Services

RefSeq Version NM_000254.2, 169790922
Length 10558 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant 1, mRNA.
Product methionine synthase isoform 1
Comment

Summary: This gene encodes the 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, May 2014].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_000245.2
CDS 424..4221
Misc Feature(1)41..466
Misc Feature(2)41..466
Misc Feature(3)64..156
Misc Feature(4)238..240
Misc Feature(5)478..4206
Misc Feature(6)478..4206
Misc Feature(7)484..1443
Misc Feature(8)1534..2304
Misc Feature(9)order(1558..1560,1768..1770,1831..1833,1837..1839,
Misc Feature(10)2434..3114
Misc Feature(11)order(2548..2550,2560..2562,2611..2613,2620..2622,
Misc Feature(12)2776..2778
Misc Feature(13)3001..3006
Misc Feature(14)3313..4164
Misc Feature(15)4102..4107
Exon (1)1..457
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (2)458..672
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (3)673..762
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (4)763..832
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (5)833..925
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (6)926..1032
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (7)1033..1092
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (8)1093..1187
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (9)1188..1288
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (10)1289..1350
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (11)1351..1418
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (12)1419..1498
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (13)1499..1611
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (14)1612..1752
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (15)1753..1938
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (16)1939..2118
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (17)2119..2235
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (18)2236..2376
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (19)2377..2466
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (20)2467..2619
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (21)2620..2727
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (22)2728..2828
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (23)2829..2896
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (24)2897..3017
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (25)3018..3099
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (26)3100..3198
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (27)3199..3274
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (28)3275..3430
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (29)3431..3627
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (30)3628..3828
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (31)3829..4021
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (32)4022..4134
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Exon (33)4135..10558
Gene:MTR
Gene Synonym:cblG; HMAG; MS
Translation MSPALQDLSQPEGLKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHA RPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMC SAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQA KGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQT GEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDET PSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSGL EPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDG MLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDD FLEKARKIKKYGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNI LTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLY HAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQGTGGKKV IQTDEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKKYPRPLNIIEGPLMNGMKIVG DLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATV KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM IFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN LKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQV FEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTL ISQKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIATFYGLRQQAEKDSASTEPYY CLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEE LHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTG IRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPIL GYDTD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
103+c, gdbSNP:187186973
117+c, tdbSNP:369473911
169+c, gdbSNP:191216755
184..185+, gdbSNP:34877975
223+c, gdbSNP:111840642
229+a, gdbSNP:116839530
complement(251)-t, cdbSNP:3738548
273+c, tdbSNP:41305572
313+c, tdbSNP:113809927
complement(357)-g, adbSNP:3738547
393+c, tdbSNP:372056489
418+c, gdbSNP:183719210
419+a, cdbSNP:368537553
432+c, gdbSNP:201975748
436+a, cdbSNP:139083778
445+c, gdbSNP:376654651
449+c, tdbSNP:201533281
478+dbSNP:
478+c, tdbSNP:376681897
533+c, tdbSNP:371079306
551+g, tdbSNP:143088011
552+g, tdbSNP:138229278
555+g, tdbSNP:373236234
564+c, tdbSNP:144151735
578+a, gdbSNP:12749581
608+c, tdbSNP:61736442
636+c, tdbSNP:200338330
731+dbSNP:
731+c, tdbSNP:367730702
772+dbSNP:
772+a, cdbSNP:143180799
779+c, tdbSNP:151161326
834+dbSNP:
834+a, gdbSNP:200061690
849+c, gdbSNP:145374086
908+c, tdbSNP:201799064
927+dbSNP:
927+a, gdbSNP:200109549
933+c, tdbSNP:142634581
981+c, tdbSNP:139019399
982+a, gdbSNP:372174747
1044+dbSNP:
1044+g, tdbSNP:148101911
1070+a, gdbSNP:201075948
1108+dbSNP:
1108+a, gdbSNP:61736441
1149+a, gdbSNP:371132663
1159+a, gdbSNP:374537482
1165+a, gdbSNP:142648132
1187+a, gdbSNP:1140598
1232+dbSNP:
1232+c, tdbSNP:375009383
1244+c, tdbSNP:368380397
complement(1258)-c, adbSNP:74767314
1269+c, tdbSNP:372141796
1281+c, tdbSNP:146019467
1317+dbSNP:
1317+c, tdbSNP:201182519
1322+c, tdbSNP:201871910
1363+dbSNP:
1363+a, gdbSNP:2229274
1415+c, tdbSNP:369312480
1456+dbSNP:
1456+a, gdbSNP:145006491
1461+a, cdbSNP:201822712
1462+c, tdbSNP:140956566
1481+c, gdbSNP:144839980
1503+dbSNP:
1503+a, gdbSNP:141861479
1512+a, cdbSNP:145217819
1518+c, tdbSNP:200961421
1552+c, tdbSNP:138876566
1556+a, gdbSNP:373066004
1564+a, gdbSNP:144777709
1573+a, gdbSNP:200473180
1604+a, gdbSNP:376183112
1607+a, gdbSNP:138734002
1629+dbSNP:
1629+c, tdbSNP:374045795
1638+a, gdbSNP:376048659
1651+c, gdbSNP:121913582
1690+c, gdbSNP:139054026
1698+a, gdbSNP:202147344
1699+a, gdbSNP:374396973
1733+a, cdbSNP:368619885
1746+c, tdbSNP:375495732
1770+dbSNP:
1770+c, tdbSNP:374136936
1785+g, tdbSNP:376684560
1789+a, gdbSNP:367759411
1818+a, gdbSNP:372015549
1843+c, tdbSNP:201765376
1860+c, tdbSNP:115424814
1901+c, tdbSNP:150652021
1908+a, gdbSNP:2229275
1965+dbSNP:
1965+a, tdbSNP:200479834
1987+c, gdbSNP:372363134
1998+a, tdbSNP:199700767
2017+a, gdbSNP:140183705
2051+c, tdbSNP:200362373
2074+a, gdbSNP:151031178
2145+dbSNP:
2145+c, tdbSNP:142857114
2176+c, tdbSNP:121913580
2190+c, tdbSNP:373453205
2217+c, tdbSNP:267598430
2276..2277+dbSNP:
2276..2277+, cdbSNP:34421688
2276..2277+, cdbSNP:397863329
2280+a, gdbSNP:150198234
2285+a, gdbSNP:61736440
2388+dbSNP:
2388+a, cdbSNP:370164038
2400+a, gdbSNP:144767461
2405+c, tdbSNP:148897041
2407+c, tdbSNP:141614780
2436+c, tdbSNP:147141232
2437+a, gdbSNP:142774813
2443+c, tdbSNP:150058137
2468+dbSNP:
2468+a, gdbSNP:113914406
2518+a, gdbSNP:181920088
2529+c, tdbSNP:186441195
2540+a, gdbSNP:147670189
2584+c, gdbSNP:190455607
2594+c, gdbSNP:144374509
2635+dbSNP:
2635+c, tdbSNP:200803446
2651+c, gdbSNP:375809201
2653+c, gdbSNP:57752780
2657+c, gdbSNP:60599724
2663+c, tdbSNP:370203138
2668+c, tdbSNP:142250261
2704+c, tdbSNP:372599491
2737+dbSNP:
2737+c, gdbSNP:370740550
2744+c, tdbSNP:201755946
2748+c, gdbSNP:376941088
complement(2750)-t, adbSNP:74710714
2763..2764+, adbSNP:35351871
2772+c, tdbSNP:150734119
2814+c, tdbSNP:149114317
2827+c, tdbSNP:138695265
2834+dbSNP:
2834+c, tdbSNP:147387989
2861+a, tdbSNP:371648406
2879+c, gdbSNP:374681119
3045+dbSNP:
3045+a, gdbSNP:141919148
3078+c, tdbSNP:139973638
3081+a, gdbSNP:142537384
3086+a, gdbSNP:201521817
3107+dbSNP:
3107+a, cdbSNP:146569329
3109+c, tdbSNP:147762307
3131+a, gdbSNP:149165917
3141+c, tdbSNP:371962565
3179+a, gdbSNP:1805087
3181+c, gdbSNP:121913579
3238+dbSNP:
3238+c, gdbSNP:113042166
3283+dbSNP:
3283+a, cdbSNP:369001514
3284+c, tdbSNP:146931200
3291+c, tdbSNP:137960622
3376+c, tdbSNP:201015844
3377+a, gdbSNP:372611712
3406+a, gdbSNP:143338646
3458+dbSNP:
3458+a, tdbSNP:201901663
3502+c, tdbSNP:116836001
3508+c, tdbSNP:139771804
3560+a, tdbSNP:374527196
3567+a, gdbSNP:2229276
3640+dbSNP:
3640+c, tdbSNP:111465715
3648+c, tdbSNP:113604788
3650+c, tdbSNP:144991102
3675+c, tdbSNP:144429636
3683+c, tdbSNP:368521476
3692+a, gdbSNP:202230081
3703+c, tdbSNP:200363767
3726+c, tdbSNP:146927804
3760+a, gdbSNP:146071220
3817+c, tdbSNP:201991154
3829+dbSNP:
3829+c, gdbSNP:183827423
3841+a, gdbSNP:150123193
3862+c, tdbSNP:201718371
3886+a, gdbSNP:369154176
3897+a, gdbSNP:142113735
3900+c, tdbSNP:117061132
3914+a, gdbSNP:61736326
3915+a, cdbSNP:12070777
3919+c, tdbSNP:12030699
3941+c, tdbSNP:121913578
3966+c, gdbSNP:112277317
3999+c, g, tdbSNP:1131449
4006+a, gdbSNP:149476106
4036+dbSNP:
4036+g, tdbSNP:121913581
4088+a, gdbSNP:61739582
4111+c, gdbSNP:138451899
4135+dbSNP:
4135+a, gdbSNP:370707501
4160+a, gdbSNP:150280831
4193+g, tdbSNP:374409316
4194+a, tdbSNP:188978680
4197+c, tdbSNP:76418646
4198+a, gdbSNP:11799647
4229+a, tdbSNP:200393845
4237+g, tdbSNP:76578123
4237+, tdbSNP:67705775
4238+g, tdbSNP:74499608
4274+a, gdbSNP:12058328
4288+a, gdbSNP:181245868
4333+a, cdbSNP:2853522
4374+a, gdbSNP:11799670
complement(4415)-t, cdbSNP:139800467
4433+c, tdbSNP:113634132
4507+c, tdbSNP:78201060
4508+a, gdbSNP:149786323
4603+c, tdbSNP:374874320
4657+a, gdbSNP:1050992
4686+a, tdbSNP:114724980
4700+a, gdbSNP:186751864
4702+c, tdbSNP:368087332
4730+a, gdbSNP:371948440
4793+c, tdbSNP:190694092
4917+a, gdbSNP:71642864
4944..4945+, gdbSNP:35177227
4964+g, tdbSNP:79987746
4968+a, tdbSNP:145714681
4982+, tdbSNP:57170329
4994+g, tdbSNP:74936029
4995+g, tdbSNP:79693925
5126+a, gdbSNP:1131450
5172+a, gdbSNP:377099183
5214+g, tdbSNP:369425600
5279+c, tdbSNP:372378677
5374+a, gdbSNP:182984560
5475+a, cdbSNP:2853523
5529+a, gdbSNP:147030371
5571+a, gdbSNP:114316012
5582+a, gdbSNP:1050993
5604+c, tdbSNP:73131123
5672+g, tdbSNP:147859146
5690+c, tdbSNP:3768159
5709+c, tdbSNP:3768160
5806+c, tdbSNP:185371406
5874+a, gdbSNP:375958366
5905+c, tdbSNP:1804742
5930+c, tdbSNP:117242127
5965+a, gdbSNP:114324996
5994+a, gdbSNP:190914070
6011..6012+, cdbSNP:34899082
6049+, adbSNP:35107824
6116+c, tdbSNP:183374463
6133+g, tdbSNP:187377255
6155+, cdbSNP:34432798
6160+g, tdbSNP:12561937
6335+a, gdbSNP:374226121
6432..6433+, gdbSNP:34672910
6511+c, gdbSNP:141401414
6540+a, gdbSNP:192307754
6609+c, gdbSNP:78990641
6612+c, gdbSNP:1050996
6650+c, tdbSNP:182908899
complement(6739)-t, gdbSNP:143561569
6759+a, gdbSNP:148021206
6781+a, gdbSNP:9779
6805+c, tdbSNP:112752174
6818+g, tdbSNP:192741032
6919+a, gdbSNP:2853639
6925+a, gdbSNP:184352906
6986..6987+, agdbSNP:34686098
6986+a, tdbSNP:201457033
6994..6995+, aadbSNP:376206128
6996+a, gdbSNP:76148815
6997..6999+, aagdbSNP:75001053
7011+a, gdbSNP:367581185
7025+c, tdbSNP:10925263
7100+a, gdbSNP:74992803
complement(7108)-g, cdbSNP:141686413
7228+a, gdbSNP:186669907
7276+g, tdbSNP:192340519
7361+a, gdbSNP:3768161
7387+c, tdbSNP:184847683
7390+a, tdbSNP:75398835
7395+c, tdbSNP:41305961
7465..7467+, tgadbSNP:368020352
7543+c, gdbSNP:76520920
7685+a, gdbSNP:61400757
7714+a, gdbSNP:41304165
7733+a, gdbSNP:41305971
7822+a, gdbSNP:59514993
7903+g, tdbSNP:6676866
7904..7905+, ttaadbSNP:149280661
7941+a, gdbSNP:182091868
7994+a, gdbSNP:80228662
8009+a, cdbSNP:184684509
8024..8026+, caadbSNP:373754008
8044+, cdbSNP:34088011
8044+c, tdbSNP:189704931
8045+, cdbSNP:398089986
8087+c, tdbSNP:375467605
8230+a, gdbSNP:141563127
8286+a, gdbSNP:6677090
8318+c, tdbSNP:11803836
8325+a, gdbSNP:372170880
8410+a, gdbSNP:146178672
8422+a, tdbSNP:1150180
complement(8426)-t, cdbSNP:77052620
8429+a, gdbSNP:114690813
8443+a, cdbSNP:181348093
8483+a, cdbSNP:185120585
8494+c, tdbSNP:74146662
8507+c, tdbSNP:6679990
8514..8515+, aacgcdbSNP:368765027
8542+c, tdbSNP:144339887
8603+c, tdbSNP:4659746
8644+c, gdbSNP:376059299
8664+c, tdbSNP:189875201
8682+g, tdbSNP:113118968
8687+a, tdbSNP:148759651
8698+c, tdbSNP:181890803
8722+c, gdbSNP:369153152
8762+c, tdbSNP:114452237
8793+, cdbSNP:35649360
8794+c, tdbSNP:186576639
8831..8832+, gdbSNP:35522391
8848+a, gdbSNP:373699977
8860+g, tdbSNP:10925264
8860+g, tdbSNP:386500713
8869+a, gdbSNP:142399284
8968+a, gdbSNP:151281658
8997+a, cdbSNP:79548228
9044+a, gdbSNP:74322958
9087+g, tdbSNP:45563435
9157..9170+, caggggccctgcctdbSNP:141576250
9158..9171+, aggggccctgcctcdbSNP:55929344
complement(9221)-t, gdbSNP:145360296
9267+c, gdbSNP:374435344
9312..9327+, cctagcaccctctctadbSNP:377725604
9325+c, gdbSNP:147659828
9353+a, gdbSNP:191528920
9381+c, tdbSNP:377725557
9391+a, gdbSNP:6680753
9415..9416+, aaaacdbSNP:371745956
9430..9434+, aaaacdbSNP:369749625
9434..9435+, aaaacdbSNP:141529013
9515+c, gdbSNP:16834539
9518+c, tdbSNP:150365053
9522+c, tdbSNP:145079645
9713..9718+, aaaaaadbSNP:145693198
9756+a, gdbSNP:16834541
9816..9817+, tdbSNP:35114693
9871+a, gdbSNP:1047027
9879+a, tdbSNP:374799052
9926..9927+, tdbSNP:144088346
9959+c, tdbSNP:149097205
9977+a, cdbSNP:16834543
9978+c, tdbSNP:143121909
10057..10058+, adbSNP:3216014
10077+a, gdbSNP:183544281
complement(10103)-t, cdbSNP:2282368
10130+c, tdbSNP:14354
10205+c, gdbSNP:115351376
10255+a, gdbSNP:188470994
10308+a, gdbSNP:1047052
10332+a, gdbSNP:375196677
10440+c, tdbSNP:74146663
10508+c, tdbSNP:141601861
10517+a, gdbSNP:116825878
Gene SymbolMTR
Gene SynonymcblG; HMAG; MS
Chromosome1
Locus Map1q43
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000254 Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant 1, mRNA. On-demand $1699.00 25
NM_001291940 Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant 3, mRNA. On-demand $899.00 20
NM_001291939 Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant 2, mRNA. On-demand $1699.00 25
XM_005273141 PREDICTED: Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant X2, mRNA. On-demand $1699.00 25
XM_006711769 PREDICTED: Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant X7, mRNA. On-demand $1699.00 25
XM_006711770 PREDICTED: Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant X8, mRNA. On-demand $899.00 20
XM_005273145 PREDICTED: Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), transcript variant X6, mRNA. On-demand $849.00 20
Title Methylenetetrahydrofolate reductase C677T and methionine synthase A2756G polymorphisms influence on leukocyte genomic DNA methylation level .
Author Weiner AS, Boyarskikh UA, Voronina EN, Mishukova OV and Filipenko ML.
Journal Gene 533 (1), 168-172 (2014)
Title Gene-environment and gene-gene interactions of specific MTHFR, MTR and CBS gene variants in relation to homocysteine in black South Africans .
Author Nienaber-Rousseau C, Ellis SM, Moss SJ, Melse-Boonstra A and Towers GW.
Journal Gene 530 (1), 113-118 (2013)
Title Role of polymorphism of methyltetrahydrofolate-homocysteine methyltransferase (MTR) A2756G and breast cancer risk .
Author Hosseini M.
Journal Pol J Pathol 64 (3), 191-195 (2013)
Title The influence of genetic RFC1, MS and MTHFR polymorphisms on the risk of acute lymphoblastic leukemia relapse in children and the adverse effects of methotrexate .
Author Niedzielska E, Weclawek-Tompol J, Matkowska-Kocjan A and Chybicka A.
Journal Adv Clin Exp Med 22 (4), 579-584 (2013)
Title Translational regulation of human methionine synthase by upstream open reading frames .
Author Col B, Oltean S and Banerjee R.
Journal Biochim. Biophys. Acta 1769 (9-10), 532-540 (2007)
Title Disorders of Intracellular Cobalamin Metabolism .
Author Carrillo-Carrasco,N., Adams,D. and Venditti,C.P.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Methionine auxotrophy in inborn errors of cobalamin metabolism .
Author Garovic-Kocic V and Rosenblatt DS.
Journal Clin Invest Med 15 (4), 395-400 (1992)
Title Aging, chronic administration of ethanol, and acute exposure to nitrous oxide: effects on vitamin B12 and folate status in rats .
Author Everman BW and Koblin DD.
Journal Mech. Ageing Dev. 62 (3), 229-243 (1992)
Title The impact of iron deficiency on the flux of folates within the mammary gland .
Author O'Connor DL, Moriarty P and Picciano MF.
Journal Int J Vitam Nutr Res 62 (2), 173-180 (1992)
Title Lysosomal cobalamin accumulation in fibroblasts from a patient with an inborn error of cobalamin metabolism (cblF complementation group): visualization by electron microscope radioautography .
Author Vassiliadis A, Rosenblatt DS, Cooper BA and Bergeron JJ.
Journal Exp. Cell Res. 195 (2), 295-302 (1991)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.