• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), mRNA.


RefSeq Accession Definition Services Price Order
NM_000254 Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), mRNA. ORF Sequence $1329.30
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000254.2, 169790922
Length 10558 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), mRNA.
Product methionine synthase
Comment

Summary: MTR encodes the enzyme 5-methyltetrahydrofolate-homocysteine methyltransferase. This enzyme, also known as cobalamin-dependent methionine synthase, catalyzes the final step in methionine biosynthesis. Mutations in MTR have been identified as the underlying cause of methylcobalamin deficiency complementation group G. [provided by RefSeq, Jul 2008].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by transcript alignments.

RefSeq NP_000245.2
CDS 424..4221
Misc Feature(1)238..240
Misc Feature(2)478..4206
Misc Feature(3)478..4206
Misc Feature(4)484..1443
Misc Feature(5)1534..2304
Misc Feature(6)order(1558..1560,1768..1770,1831..1833,1837..1839,
Misc Feature(7)2434..3114
Misc Feature(8)order(2548..2550,2560..2562,2611..2613,2620..2622,
Misc Feature(9)2776..2778
Misc Feature(10)3001..3006
Misc Feature(11)3703..4113
Misc Feature(12)4102..4107
Exon (1)1..457
Gene:MTR
Gene Synonym:cblG; MS
Exon (2)458..672
Gene:MTR
Gene Synonym:cblG; MS
Exon (3)673..762
Gene:MTR
Gene Synonym:cblG; MS
Exon (4)763..832
Gene:MTR
Gene Synonym:cblG; MS
Exon (5)833..925
Gene:MTR
Gene Synonym:cblG; MS
Exon (6)926..1032
Gene:MTR
Gene Synonym:cblG; MS
Exon (7)1033..1092
Gene:MTR
Gene Synonym:cblG; MS
Exon (8)1093..1187
Gene:MTR
Gene Synonym:cblG; MS
Exon (9)1188..1288
Gene:MTR
Gene Synonym:cblG; MS
Exon (10)1289..1350
Gene:MTR
Gene Synonym:cblG; MS
Exon (11)1351..1418
Gene:MTR
Gene Synonym:cblG; MS
Exon (12)1419..1498
Gene:MTR
Gene Synonym:cblG; MS
Exon (13)1499..1611
Gene:MTR
Gene Synonym:cblG; MS
Exon (14)1612..1752
Gene:MTR
Gene Synonym:cblG; MS
Exon (15)1753..1938
Gene:MTR
Gene Synonym:cblG; MS
Exon (16)1939..2118
Gene:MTR
Gene Synonym:cblG; MS
Exon (17)2119..2235
Gene:MTR
Gene Synonym:cblG; MS
Exon (18)2236..2376
Gene:MTR
Gene Synonym:cblG; MS
Exon (19)2377..2466
Gene:MTR
Gene Synonym:cblG; MS
Exon (20)2467..2619
Gene:MTR
Gene Synonym:cblG; MS
Exon (21)2620..2727
Gene:MTR
Gene Synonym:cblG; MS
Exon (22)2728..2828
Gene:MTR
Gene Synonym:cblG; MS
Exon (23)2829..2896
Gene:MTR
Gene Synonym:cblG; MS
Exon (24)2897..3017
Gene:MTR
Gene Synonym:cblG; MS
Exon (25)3018..3099
Gene:MTR
Gene Synonym:cblG; MS
Exon (26)3100..3198
Gene:MTR
Gene Synonym:cblG; MS
Exon (27)3199..3274
Gene:MTR
Gene Synonym:cblG; MS
Exon (28)3275..3430
Gene:MTR
Gene Synonym:cblG; MS
Exon (29)3431..3627
Gene:MTR
Gene Synonym:cblG; MS
Exon (30)3628..3828
Gene:MTR
Gene Synonym:cblG; MS
Exon (31)3829..4021
Gene:MTR
Gene Synonym:cblG; MS
Exon (32)4022..4134
Gene:MTR
Gene Synonym:cblG; MS
Exon (33)4135..10558
Gene:MTR
Gene Synonym:cblG; MS
Translation MSPALQDLSQPEGLKKTLRDEINAILQKRIMVLDGGMGTMIQREKLNEEHFRGQEFKDHA RPLKGNNDILSITQPDVIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNMC SAGVARKAAEEVTLQTGIKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYQEQA KGLLDGGVDILLIETIFDTANAKAALFALQNLFEEKYAPRPIFISGTIVDKSGRTLSGQT GEGFVISVSHGEPLCIGLNCALGAAEMRPFIEIIGKCTTAYVLCYPNAGLPNTFGDYDET PSMMAKHLKDFAMDGLVNIVGGCCGSTPDHIREIAEAVKNCKPRVPPATAFEGHMLLSGL EPFRIGPYTNFVNIGERCNVAGSRKFAKLIMAGNYEEALCVAKVQVEMGAQVLDVNMDDG MLDGPSAMTRFCNLIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEDD FLEKARKIKKYGAAMVVMAFDEEGQATETDTKIRVCTRAYHLLVKKLGFNPNDIIFDPNI LTIGTGMEEHNLYAINFIHATKVIKETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLY HAIKSGMDMGIVNAGNLPVYDDIHKELLQLCEDLIWNKDPEATEKLLRYAQTQGTGGKKV IQTDEWRNGPVEERLEYALVKGIEKHIIEDTEEARLNQKKYPRPLNIIEGPLMNGMKIVG DLFGAGKMFLPQVIKSARVMKKAVGHLIPFMEKEREETRVLNGTVEEEDPYQGTIVLATV KGDVHDIGKNIVGVVLGCNNFRVIDLGVMTPCDKILKAALDHKADIIGLSGLITPSLDEM IFVAKEMERLAIRIPLLIGGATTSKTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDEN LKDEYFEEIMEEYEDIRQDHYESLKERRYLPLSQARKSGFQMDWLSEPHPVKPTFIGTQV FEDYDLQKLVDYIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVGGEARKVYDDAHNMLNTL ISQKKLRARGVVGFWPAQSIQDDIHLYAEAAVPQAAEPIATFYGLRQQAEKDSASTEPYY CLSDFIAPLHSGIRDYLGLFAVACFGVEELSKAYEDDGDDYSSIMVKALGDRLAEAFAEE LHERVRRELWAYCGSEQLDVADLRRLRYKGIRPAPGYPSQPDHTEKLTMWRLADIEQSTG IRLTESLAMAPASAVSGLYFSNLKSKYFAVGKISKDQVEDYALRKNISVAEVEKWLGPIL GYDTD
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
103+dbSNP:
103+c, gdbSNP:187186973
169+c, gdbSNP:191216755
184..185+, gdbSNP:34877975
223+c, gdbSNP:111840642
229+a, gdbSNP:116839530
251+c, tdbSNP:3738548
273+c, tdbSNP:41305572
313+c, tdbSNP:113809927
357+a, gdbSNP:3738547
418+c, gdbSNP:183719210
432+c, gdbSNP:201975748
436+a, cdbSNP:139083778
449+c, tdbSNP:201533281
551+dbSNP:
551+g, tdbSNP:143088011
552+g, tdbSNP:138229278
564+c, tdbSNP:144151735
578+a, gdbSNP:12749581
608+c, tdbSNP:61736442
636+c, tdbSNP:200338330
772+dbSNP:
772+a, cdbSNP:143180799
779+c, tdbSNP:151161326
834+dbSNP:
834+a, gdbSNP:200061690
849+c, gdbSNP:145374086
908+c, tdbSNP:201799064
927+dbSNP:
927+a, gdbSNP:200109549
933+c, tdbSNP:142634581
981+c, tdbSNP:139019399
1044+dbSNP:
1044+g, tdbSNP:148101911
1070+a, gdbSNP:201075948
1108+dbSNP:
1108+a, gdbSNP:61736441
1165+a, gdbSNP:142648132
1187+a, gdbSNP:1140598
1258+dbSNP:
1258+a, cdbSNP:74767314
1281+c, tdbSNP:146019467
1317+dbSNP:
1317+c, tdbSNP:201182519
1322+c, tdbSNP:201871910
1363+dbSNP:
1363+a, gdbSNP:2229274
1456+dbSNP:
1456+a, gdbSNP:145006491
1461+a, cdbSNP:201822712
1462+c, tdbSNP:140956566
1481+c, gdbSNP:144839980
1503+dbSNP:
1503+a, gdbSNP:141861479
1512+a, cdbSNP:145217819
1518+c, tdbSNP:200961421
1552+c, tdbSNP:138876566
1564+a, gdbSNP:144777709
1573+a, gdbSNP:200473180
1607+a, gdbSNP:138734002
1651+dbSNP:
1651+c, gdbSNP:121913582
1690+c, gdbSNP:139054026
1698+a, gdbSNP:202147344
1843+dbSNP:
1843+c, tdbSNP:201765376
1860+c, tdbSNP:115424814
1901+c, tdbSNP:150652021
1908+a, gdbSNP:2229275
1965+dbSNP:
1965+a, tdbSNP:200479834
1998+a, tdbSNP:199700767
2017+a, gdbSNP:140183705
2051+c, tdbSNP:200362373
2074+a, gdbSNP:151031178
2145+dbSNP:
2145+c, tdbSNP:142857114
2176+c, tdbSNP:121913580
2274..2275+dbSNP:
2274..2275+, cdbSNP:34421688
2280+a, gdbSNP:150198234
2285+a, gdbSNP:61736440
2400+dbSNP:
2400+a, gdbSNP:144767461
2405+c, tdbSNP:148897041
2407+c, tdbSNP:141614780
2436+c, tdbSNP:147141232
2437+a, gdbSNP:142774813
2443+c, tdbSNP:150058137
2468+dbSNP:
2468+a, gdbSNP:113914406
2518+a, gdbSNP:181920088
2529+c, tdbSNP:186441195
2540+a, gdbSNP:147670189
2584+c, gdbSNP:190455607
2594+c, gdbSNP:144374509
2635+dbSNP:
2635+c, tdbSNP:200803446
2653+c, gdbSNP:57752780
2657+c, gdbSNP:60599724
2668+c, tdbSNP:142250261
2680+a, gdbSNP:144323091
2738+dbSNP:
2738+a, gdbSNP:146720782
2744+c, tdbSNP:201755946
2750+a, tdbSNP:74710714
2763..2764+, adbSNP:35351871
2772+c, tdbSNP:150734119
2814+c, tdbSNP:149114317
2827+c, tdbSNP:138695265
2834+dbSNP:
2834+c, tdbSNP:147387989
3045+dbSNP:
3045+a, gdbSNP:141919148
3078+c, tdbSNP:139973638
3081+a, gdbSNP:142537384
3086+a, gdbSNP:201521817
3107+dbSNP:
3107+a, cdbSNP:146569329
3109+c, tdbSNP:147762307
3131+a, gdbSNP:149165917
3179+a, gdbSNP:1805087
3181+c, gdbSNP:121913579
3238+dbSNP:
3238+c, gdbSNP:113042166
3284+dbSNP:
3284+c, tdbSNP:146931200
3291+c, tdbSNP:137960622
3376+c, tdbSNP:201015844
3406+a, gdbSNP:143338646
3458+dbSNP:
3458+a, tdbSNP:201901663
3502+c, tdbSNP:116836001
3508+c, tdbSNP:139771804
3567+a, gdbSNP:2229276
3640+dbSNP:
3640+c, tdbSNP:111465715
3648+c, tdbSNP:113604788
3650+c, tdbSNP:144991102
3675+c, tdbSNP:144429636
3692+a, gdbSNP:202230081
3703+c, tdbSNP:200363767
3726+c, tdbSNP:146927804
3760+a, gdbSNP:146071220
3817+c, tdbSNP:201991154
3829+dbSNP:
3829+c, gdbSNP:183827423
3841+a, gdbSNP:150123193
3862+c, tdbSNP:201718371
3897+a, gdbSNP:142113735
3900+c, tdbSNP:117061132
3914+a, gdbSNP:61736326
3915+a, cdbSNP:12070777
3919+c, tdbSNP:12030699
3941+c, tdbSNP:121913578
3966+c, gdbSNP:112277317
3999+c, g, tdbSNP:1131449
4006+a, gdbSNP:149476106
4036+dbSNP:
4036+g, tdbSNP:121913581
4088+a, gdbSNP:61739582
4111+c, gdbSNP:138451899
4160+dbSNP:
4160+a, gdbSNP:150280831
4194+a, tdbSNP:188978680
4197+c, tdbSNP:76418646
4198+a, gdbSNP:11799647
4223+, tdbSNP:67705775
4229+a, tdbSNP:200393845
4237+g, tdbSNP:76578123
4238+g, tdbSNP:74499608
4274+a, gdbSNP:12058328
4288+a, gdbSNP:181245868
4333+a, cdbSNP:2853522
4374+a, gdbSNP:11799670
4415+c, tdbSNP:139800467
4433+c, tdbSNP:113634132
4507+c, tdbSNP:78201060
4508+a, gdbSNP:149786323
4657+a, gdbSNP:1050992
4686+a, tdbSNP:114724980
4700+a, gdbSNP:186751864
4793+c, tdbSNP:190694092
4917+a, gdbSNP:71642864
4944..4945+, gdbSNP:35177227
4964+g, tdbSNP:79987746
4968+a, tdbSNP:145714681
4982+, tdbSNP:57170329
4994+g, tdbSNP:74936029
4995+g, tdbSNP:79693925
5126+a, gdbSNP:1131450
5374+a, gdbSNP:182984560
5475+a, cdbSNP:2853523
5529+a, gdbSNP:147030371
5571+a, gdbSNP:114316012
5582+a, gdbSNP:1050993
5604+c, tdbSNP:73131123
5672+g, tdbSNP:147859146
5690+c, tdbSNP:3768159
5709+c, tdbSNP:3768160
5806+c, tdbSNP:185371406
5905+c, tdbSNP:1804742
5930+c, tdbSNP:117242127
5965+a, gdbSNP:114324996
5994+a, gdbSNP:190914070
6010..6011+, cdbSNP:34899082
6049+, adbSNP:35107824
6116+c, tdbSNP:183374463
6133+g, tdbSNP:187377255
6155+, cdbSNP:34432798
6160+g, tdbSNP:12561937
6432..6433+, gdbSNP:34672910
6511+c, gdbSNP:141401414
6540+a, gdbSNP:192307754
6609+c, gdbSNP:78990641
6612+c, gdbSNP:1050996
6650+c, tdbSNP:182908899
6739+g, tdbSNP:143561569
6759+a, gdbSNP:148021206
6781+a, gdbSNP:9779
6805+c, tdbSNP:112752174
6818+g, tdbSNP:192741032
6919+a, gdbSNP:2853639
6925+a, gdbSNP:184352906
6986..6987+, adbSNP:139514399
6986+a, tdbSNP:201457033
6987..6988+, aadbSNP:71700648
6994..6996+, aagdbSNP:75001053
6995..6996+, a, ag, gdbSNP:34686098
6996+a, gdbSNP:76148815
6996+, gadbSNP:67341654
7025+c, tdbSNP:10925263
7100+a, gdbSNP:74992803
7108+c, gdbSNP:141686413
7228+a, gdbSNP:186669907
7276+g, tdbSNP:192340519
7361+a, gdbSNP:3768161
7387+c, tdbSNP:184847683
7390+a, tdbSNP:75398835
7395+c, tdbSNP:41305961
7543+c, gdbSNP:76520920
7685+a, gdbSNP:61400757
7714+a, gdbSNP:41304165
7733+a, gdbSNP:41305971
7822+a, gdbSNP:59514993
7903+g, tdbSNP:6676866
7904..7905+, ttaadbSNP:149280661
7941+a, gdbSNP:182091868
7994+a, gdbSNP:80228662
8009+a, cdbSNP:184684509
8044+, cdbSNP:34088011
8044+c, tdbSNP:189704931
8230+a, gdbSNP:141563127
8286+a, gdbSNP:6677090
8318+c, tdbSNP:11803836
8410+a, gdbSNP:146178672
8422+a, tdbSNP:1150180
8426+c, tdbSNP:77052620
8429+a, gdbSNP:114690813
8443+a, cdbSNP:181348093
8483+a, cdbSNP:185120585
8494+c, tdbSNP:74146662
8507+c, tdbSNP:6679990
8542+c, tdbSNP:144339887
8603+c, tdbSNP:4659746
8664+c, tdbSNP:189875201
8682+g, tdbSNP:113118968
8687+a, tdbSNP:148759651
8698+c, tdbSNP:181890803
8762+c, tdbSNP:114452237
8793+, cdbSNP:35649360
8794+c, tdbSNP:186576639
8831..8832+, gdbSNP:35522391
8860+g, tdbSNP:10925264
8869+a, gdbSNP:142399284
8968+a, gdbSNP:151281658
8997+a, cdbSNP:79548228
9044+a, gdbSNP:74322958
9087+g, tdbSNP:45563435
9157..9170+, caggggccctgcctdbSNP:141576250
9158..9171+, aggggccctgcctcdbSNP:55929344
9221+g, tdbSNP:145360296
9325+c, gdbSNP:147659828
9353+a, gdbSNP:191528920
9391+a, gdbSNP:6680753
9414..9415+, aaaacdbSNP:141529013
9515+c, gdbSNP:16834539
9518+c, tdbSNP:150365053
9522+c, tdbSNP:145079645
9713..9718+, aaaaaadbSNP:145693198
9756+a, gdbSNP:16834541
9814..9815+, tdbSNP:35114693
9871+a, gdbSNP:1047027
9925..9926+, tdbSNP:144088346
9959+c, tdbSNP:149097205
9977+a, cdbSNP:16834543
9978+c, tdbSNP:143121909
10057..10058+, adbSNP:3216014
10077+a, gdbSNP:183544281
10103+c, tdbSNP:2282368
10130+c, tdbSNP:14354
10205+c, gdbSNP:115351376
10255+a, gdbSNP:188470994
10308+a, gdbSNP:1047052
10440+c, tdbSNP:74146663
10508+c, tdbSNP:141601861
10517+a, gdbSNP:116825878
Gene SymbolMTR
Gene SynonymcblG; MS
Chromosome1
Locus Map1q43
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000254 Homo sapiens 5-methyltetrahydrofolate-homocysteine methyltransferase (MTR), mRNA. Full Length Quote
ORF Sequence $1329.30
Title Interaction of MTHFR C677T and A1298C, and MTR A2756G gene polymorphisms in breast cancer risk in a population in Northeast Brazil .
Author de Cassia Carvalho Barbosa,R., da Costa,D.M., Cordeiro,D.E., Vieira,A.P. and Rabenhorst,S.H.
Journal Anticancer Res. 32 (11), 4805-4811 (2012)
Title Polymorphisms in folate-metabolizing genes and risk of having an offspring with congenital anomalies in the West Siberian region of Russia: a case-control study .
Author Weiner,A.S., Gordeeva,L.A., Voronina,E.N., Boyarskikh,U.A., Shabaldin,A.V. and Filipenko,M.L.
Journal Prenat. Diagn. 32 (11), 1041-1048 (2012)
Title Role of polymorphic variants of MTR gene A2756G and SHMT1 gene C1420T in the development of prostatic cancer in residents of the Western Siberian Region of Russia .
Author Weiner,A.S., Oskina,N.A., Lacarev,A.F., Petrova,V.D., Ganov,D.I., Boyarskih,U.A., Tonacheva,O.G., Voronina,E.N. and Filipenko,M.L.
Journal Bull. Exp. Biol. Med. 152 (4), 466-469 (2012)
Title The polymorphisms in methylenetetrahydrofolate reductase, methionine synthase, methionine synthase reductase, and the risk of colorectal cancer .
Author Zhou,D., Mei,Q., Luo,H., Tang,B. and Yu,P.
Journal Int. J. Biol. Sci. 8 (6), 819-830 (2012)
Title Polymorphisms in MTHFR, MS and CBS genes and homocysteine levels in a Pakistani population .
Author Yakub,M., Moti,N., Parveen,S., Chaudhry,B., Azam,I. and Iqbal,M.P.
Journal PLoS ONE 7 (3), E33222 (2012)
Title Methionine auxotrophy in inborn errors of cobalamin metabolism .
Author Garovic-Kocic,V. and Rosenblatt,D.S.
Journal Clin Invest Med 15 (4), 395-400 (1992)
Title Aging, chronic administration of ethanol, and acute exposure to nitrous oxide: effects on vitamin B12 and folate status in rats .
Author Everman,B.W. and Koblin,D.D.
Journal Mech. Ageing Dev. 62 (3), 229-243 (1992)
Title The impact of iron deficiency on the flux of folates within the mammary gland .
Author O'Connor,D.L., Moriarty,P. and Picciano,M.F.
Journal Int J Vitam Nutr Res 62 (2), 173-180 (1992)
Title Lysosomal cobalamin accumulation in fibroblasts from a patient with an inborn error of cobalamin metabolism (cblF complementation group): visualization by electron microscope radioautography .
Author Vassiliadis,A., Rosenblatt,D.S., Cooper,B.A. and Bergeron,J.J.
Journal Exp. Cell Res. 195 (2), 295-302 (1991)
Title Cobalamin-dependent methionine synthase .
Author Banerjee,R.V. and Matthews,R.G.
Journal FASEB J. 4 (5), 1450-1459 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878