• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin binding protein C, cardiac (MYBPC3), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu44879 Homo sapiens myosin binding protein C, cardiac (MYBPC3), mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu44879C Homo sapiens myosin binding protein C, cardiac (MYBPC3), mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000256.3, 148596956
Length 3825 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens myosin binding protein C, cardiac (MYBPC3), mRNA.
Product myosin-binding protein C, cardiac-type
Comment

Summary: MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3, the cardiac isoform, is expressed exclussively in heart muscle. Regulatory phosphorylation of the cardiac isoform in vivo by cAMP-dependent protein kinase (PKA) upon adrenergic stimulation may be linked to modulation of cardiac contraction. Mutations in MYBPC3 are one cause of familial hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008].

RefSeq NP_000247.2
CDS 56..3880
Misc Feature(1)89..337
Misc Feature(2)89..337
Misc Feature(3)98..322
Misc Feature(4)536..823
Misc Feature(5)596..787
Misc Feature(6)1148..1402
Misc Feature(7)1172..1174
Misc Feature(8)1226..1369
Misc Feature(9)1421..1678
Misc Feature(10)1466..>1630
Misc Feature(11)1742..1942
Misc Feature(12)2015..2359
Misc Feature(13)2018..2359
Misc Feature(14)2369..2641
Misc Feature(15)order(2369..2371,2567..2569,2612..2614)
Misc Feature(16)order(2615..2620,2624..2629)
Misc Feature(17)2663..2944
Misc Feature(18)order(2663..2665,2861..2863,2906..2908)
Misc Feature(19)order(2909..2914,2918..2923)
Misc Feature(20)2996..3241
Misc Feature(21)3023..3241
Misc Feature(22)3251..3517
Misc Feature(23)order(3251..3253,3446..3448,3491..3493)
Misc Feature(24)order(3494..3499,3503..3508)
Misc Feature(25)3596..3865
Misc Feature(26)3647..3850
Exon (1)1..80
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (2)81..347
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (3)348..461
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (4)462..560
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (5)561..709
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (6)710..827
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (7)828..876
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (8)877..906
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (9)907..960
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (10)961..963
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (11)964..981
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (12)982..1145
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (13)1146..1278
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (14)1279..1281
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (15)1282..1406
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (16)1407..1512
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (17)1513..1679
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (18)1680..1845
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (19)1846..1952
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (20)1953..1982
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (21)1983..2122
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (22)2123..2203
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (23)2204..2363
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (24)2364..2468
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (25)2469..2657
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (26)2658..2792
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (27)2793..2960
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (28)2961..3049
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (29)3050..3245
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (30)3246..3385
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (31)3386..3545
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (32)3546..3682
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (33)3683..3869
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (34)3870..3906
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Exon (35)3907..4217
Gene:MYBPC3
Gene Synonym:CMD1MM; CMH4; FHC; LVNC10; MYBP-C
Translation MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATE GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEA PAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG ASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCE VSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLK KRDSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK KSTAFQKKLEPAYQVSKGHKIRLTVELADHDAEVKWLKNGQEIQMSGSKYIFESIGAKRT LTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEE GAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIV QEKKLEVYQSIADLMVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKVSHIGRVHK LTIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIV VVAGNKLRLDVPISGDPAPTVIWQKAITQGNKAPARPAPDAPEDTGDSDEWVFDKKLLCE TEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKI SNVGEDSCTVQWEPPAYDGGQPILGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGV VYEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDVSDTTVSLKWRPPERVGAGG LDGYSVEYCPEGCSEWVAALQGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTE PVTVQEILQRPRLQLPRHLRQTIQKKVGEPVNLLIPFQGKPRPQVTWTKEGQPLAGEEVS IRNSPTDTILFIRAARRVHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTDAWGL NVALEWKPPQDVGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVF SQNMVGFSDRAATTKEPVFIPRPGITYEPPNYKALDFSEAPSFTQPLVNRSVIAGYTAML CCAVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQG EARCECRLEVRVPQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(32)-dbSNP:
complement(32)-t, cdbSNP:369797789
58+c, gdbSNP:397516045
complement(67)-t, cdbSNP:377292092
complement(68)-g, cdbSNP:201278114
complement(88)-dbSNP:
complement(88)-t, cdbSNP:2596402
complement(105)-t, cdbSNP:374630007
complement(129)-t, cdbSNP:371140684
148+c, tdbSNP:397516085
159+a, gdbSNP:397515885
complement(162)-t, gdbSNP:376646845
complement(176)-t, g, adbSNP:373638535
complement(186)-t, cdbSNP:369205562
complement(187)-g, adbSNP:377579620
complement(203)-t, cdbSNP:373164247
complement(205)-g, adbSNP:368918487
221+a, gdbSNP:397515918
230+a, gdbSNP:121909375
232..242+, agagggcacacdbSNP:397515925
complement(239)-t, gdbSNP:377225516
complement(242)-g, adbSNP:373315466
complement(250)-t, cdbSNP:370102200
261+a, gdbSNP:397515945
262+c, gdbSNP:397515946
263+g, tdbSNP:11570045
complement(263)-c, adbSNP:386519581
complement(278)-t, cdbSNP:375471260
complement(301)-g, adbSNP:372502369
complement(325)-g, adbSNP:367990952
345+c, tdbSNP:397515993
381+dbSNP:
381+c, tdbSNP:397516011
388+c, tdbSNP:397516017
405+, cdbSNP:397516023
410+a, gdbSNP:397516025
417+, cdbSNP:397516032
427+c, tdbSNP:11570046
complement(427)-g, adbSNP:386519582
complement(428)-c, adbSNP:370958401
457+c, tdbSNP:397516046
486..487+dbSNP:
486..487+, gtdbSNP:397516047
491..492+, adbSNP:397516049
491+a, cdbSNP:397516048
497+a, gdbSNP:397516050
complement(505)-g, adbSNP:377520770
506+a, gdbSNP:397516051
514+, cdbSNP:397516052
complement(516)-g, adbSNP:373946195
complement(526)-g, adbSNP:150291001
complement(533)-g, adbSNP:193068692
536+a, cdbSNP:397516053
complement(538)-t, cdbSNP:373133807
556+c, tdbSNP:397516054
complement(567)-dbSNP:
complement(567)-t, cdbSNP:369683229
complement(573)-t, g, adbSNP:113941605
584+c, tdbSNP:193922385
complement(585)-t, cdbSNP:201012766
complement(586)-g, adbSNP:368035400
complement(592)-t, cdbSNP:11570051
595..614+, cgccagcctcctgaagccgcdbSNP:397516058
complement(595)-g, adbSNP:371842442
complement(604)-g, adbSNP:368604485
606..607+, tdbSNP:397516059
complement(608)-t, gdbSNP:375607980
complement(613)-t, c, adbSNP:370962887
620+a, gdbSNP:11570052
621+a, tdbSNP:397516060
complement(637)-t, gdbSNP:375673378
complement(653)-t, cdbSNP:370554185
668+c, tdbSNP:397516061
complement(679)-g, cdbSNP:202139499
691+c, gdbSNP:397516062
698+c, tdbSNP:397516063
700+c, tdbSNP:397516064
complement(701)-t, cdbSNP:201098973
complement(704)-t, cdbSNP:138753870
710+dbSNP:
710+c, gdbSNP:397516068
complement(721)-g, adbSNP:371331114
722+a, gdbSNP:397516069
complement(737)-t, cdbSNP:369300885
complement(761)-t, cdbSNP:386584787
765+a, cdbSNP:397516070
complement(794)-g, adbSNP:372574446
799+a, cdbSNP:2857543
800+c, tdbSNP:397516071
complement(807)-t, adbSNP:368588523
827+a, gdbSNP:397516074
complement(831)-dbSNP:
complement(831)-g, adbSNP:187455402
841+c, tdbSNP:11570058
complement(842)-t, cdbSNP:373730381
complement(854)-g, cdbSNP:370941975
869+c, tdbSNP:397516075
complement(873)-t, cdbSNP:376461745
complement(888)-dbSNP:
complement(888)-t, cdbSNP:147315081
complement(891)-g, cdbSNP:375774648
complement(896)-g, adbSNP:371711564
complement(897)-g, adbSNP:11570060
complement(897)-g, adbSNP:386519583
complement(964)-dbSNP:
complement(964)-g, adbSNP:200713257
968..969+, ttdbSNP:397516080
complement(972)-t, cdbSNP:373204728
complement(976)-t, gdbSNP:370632180
986+dbSNP:
986+a, tdbSNP:397516084
987+a, cdbSNP:193922386
complement(988)-t, g, cdbSNP:374326087
complement(1015)-g, adbSNP:369900803
complement(1016)-t, cdbSNP:200119454
complement(1032)-g, adbSNP:34580776
1049+a, gdbSNP:397516086
complement(1054)-g, adbSNP:367947846
1063+c, tdbSNP:397515880
1076+a, gdbSNP:397515881
1079+a, gdbSNP:397515882
1092+a, gdbSNP:397515883
1094+a, gdbSNP:397515884
complement(1111)-g, cdbSNP:375007425
complement(1125)-t, cdbSNP:199741162
complement(1126)-g, adbSNP:371308153
1167+dbSNP:
1167+c, gdbSNP:397515887
complement(1199)-t, cdbSNP:11570076
complement(1202)-g, cdbSNP:11570077
1211+g, tdbSNP:397515888
1223+, cdbSNP:397515889
complement(1228)-g, adbSNP:377328238
1243+g, tdbSNP:397515890
1290..1291+dbSNP:
1290..1291+, ttdbSNP:397515894
complement(1301)-t, cdbSNP:371513491
complement(1310)-t, g, adbSNP:368770848
1328+c, tdbSNP:397515895
complement(1341)-g, adbSNP:370412052
complement(1345)-g, adbSNP:200664621
complement(1349)-t, cdbSNP:371167525
complement(1357)-g, adbSNP:190228518
1365+, tdbSNP:397515896
complement(1374)-t, cdbSNP:142317339
complement(1375)-g, adbSNP:368192024
1376+a, gdbSNP:193922377
1413+dbSNP:
1413+c, tdbSNP:397515898
complement(1425)-g, adbSNP:370538243
complement(1427)-g, adbSNP:377577698
complement(1428)-t, cdbSNP:374255707
1452+a, tdbSNP:397515899
1473+c, tdbSNP:397515900
1477+c, gdbSNP:397515901
complement(1500)-g, adbSNP:370285346
1511+g, tdbSNP:397515902
complement(1522)-dbSNP:
complement(1522)-t, cdbSNP:35690719
complement(1523)-t, cdbSNP:200625851
1524+g, tdbSNP:397514752
1538+c, gdbSNP:397515905
complement(1539)-t, cdbSNP:200411226
1549+c, gdbSNP:397515906
complement(1559)-g, adbSNP:375882485
1560+a, gdbSNP:397515907
1573+c, tdbSNP:397515908
complement(1574)-g, adbSNP:35736435
1590+a, tdbSNP:397515909
complement(1599)-t, cdbSNP:181834806
complement(1609)-t, cdbSNP:372499440
complement(1618)-g, adbSNP:367915627
complement(1619)-g, adbSNP:11570082
complement(1620)-g, adbSNP:370362589
complement(1621)-t, cdbSNP:376041792
1630+g, tdbSNP:397515910
1641+c, gdbSNP:397515911
1646+c, gdbSNP:397515912
complement(1656)-g, adbSNP:374349666
complement(1657)-t, cdbSNP:370945942
complement(1663)-t, adbSNP:200224422
1679+c, gdbSNP:121909374
complement(1688)-dbSNP:
complement(1688)-t, gdbSNP:377163678
1696..1697+, gtdbSNP:398123279
1696+a, gdbSNP:397515915
1739+a, gdbSNP:397515919
1748+a, tdbSNP:397515920
1774+g, tdbSNP:397515921
complement(1775)-t, gdbSNP:61897383
1776+a, gdbSNP:397515922
1821+a, gdbSNP:397515923
1833+c, tdbSNP:397515924
complement(1841)-t, cdbSNP:199728019
complement(1844)-g, adbSNP:201596087
1855+dbSNP:
1855+, adbSNP:397515926
1858+a, gdbSNP:397515927
1863+c, tdbSNP:397515928
1867+c, tdbSNP:397515929
complement(1868)-t, cdbSNP:376736293
1869..1871+, acgdbSNP:397515930
complement(1869)-t, cdbSNP:372371774
complement(1871)-t, cdbSNP:368482358
complement(1875)-g, adbSNP:375196922
complement(1883)-t, g, cdbSNP:371564200
complement(1910)-t, cdbSNP:200352299
1918+, cdbSNP:397515931
1918+c, tdbSNP:193922378
1924+c, tdbSNP:397515932
1947+, tdbSNP:397515933
1950+, tdbSNP:397515934
complement(1969)-dbSNP:
complement(1969)-g, adbSNP:377227442
1989+dbSNP:
1989+c, tdbSNP:397515938
2015+c, tdbSNP:397515939
2016+a, gdbSNP:1800565
complement(2018)-t, gdbSNP:374447249
2023+a, gdbSNP:397515940
2031+c, tdbSNP:397515941
complement(2044)-t, adbSNP:375467797
2068..2071+ccct, ggdbSNP:397515943
complement(2090)-g, adbSNP:372493586
2095..2096+, tdbSNP:397515944
2103+a, gdbSNP:397515942
complement(2111)-g, cdbSNP:367992212
2118+a, c, tdbSNP:3729946
2151+dbSNP:
2151+, cdbSNP:397515947
2168..2169+, adbSNP:397515948
complement(2179)-g, adbSNP:113658284
complement(2183)-g, cdbSNP:371020684
2218+dbSNP:
2218+, cdbSNP:397515952
2218+c, tdbSNP:397515951
complement(2225)-g, adbSNP:200399246
2232+a, gdbSNP:397515953
complement(2233)-g, adbSNP:370676057
2237+g, tdbSNP:397515954
2251+c, tdbSNP:397515955
2252+c, tdbSNP:397515956
complement(2265)-g, adbSNP:199893357
complement(2266)-t, cdbSNP:113265977
complement(2305)-t, cdbSNP:373338699
complement(2324)-t, cdbSNP:369790992
2329+c, tdbSNP:397515957
2365+dbSNP:
2365+c, tdbSNP:397515959
2366..2367+, gdbSNP:397515960
complement(2366)-t, cdbSNP:371488302
2367+c, tdbSNP:397515961
2374+c, tdbSNP:397515962
complement(2375)-t, cdbSNP:368104687
2428..2429+, gdbSNP:397515963
complement(2429)-g, c, adbSNP:187830361
complement(2464)-t, gdbSNP:202088839
2465+a, cdbSNP:3729950
complement(2465)-t, gdbSNP:386584785
complement(2484)-dbSNP:
complement(2484)-t, cdbSNP:375675796
2505+a, gdbSNP:397515964
2509+a, gdbSNP:397515965
complement(2514)-t, cdbSNP:386575466
complement(2534)-t, gdbSNP:375322174
complement(2542)-c, adbSNP:201040413
2545..2546+, tdbSNP:397515966
complement(2552)-t, cdbSNP:199865688
complement(2553)-t, cdbSNP:3729952
2554+a, gdbSNP:397515967
2567+a, gdbSNP:397515969
complement(2572)-g, adbSNP:370561202
complement(2573)-t, cdbSNP:376936056
2579..2580+, tdbSNP:397515970
2580+a, gdbSNP:397515971
complement(2581)-g, adbSNP:373792537
2583..2591+, agatgcgcgdbSNP:397515972
2589..2593+, gcgtcdbSNP:397515973
2592+a, tdbSNP:193922379
2596+c, gdbSNP:397515974
complement(2599)-t, cdbSNP:369904619
2602+c, tdbSNP:3729953
2611..2612+cg, tctdbSNP:397515975
2612+a, gdbSNP:397515976
2613+, gdbSNP:397515977
complement(2615)-t, cdbSNP:373171036
2656+c, tdbSNP:11570097
2665..2666+dbSNP:
2665..2666+, cdbSNP:397515979
complement(2669)-t, cdbSNP:190765116
complement(2673)-t, g, adbSNP:371401403
2695+c, tdbSNP:397515980
2709+c, tdbSNP:397515981
2725+a, gdbSNP:397515982
complement(2737)-c, adbSNP:369289966
complement(2738)-g, adbSNP:374976635
complement(2739)-t, cdbSNP:372628478
2741+a, gdbSNP:35078470
2769+a, gdbSNP:397515983
2778+a, gdbSNP:397515984
2783+a, cdbSNP:397515985
complement(2808..2809)-dbSNP:
complement(2808..2809)-, cdbSNP:34114081
complement(2816)-g, cdbSNP:367729718
complement(2826)-g, adbSNP:200406864
complement(2839)-t, g, cdbSNP:372510974
complement(2855)-g, adbSNP:367980215
complement(2862)-t, gdbSNP:374946555
complement(2863)-t, cdbSNP:370530334
2882+c, tdbSNP:387907267
2883+a, gdbSNP:397515986
2888..2889+, cgdbSNP:397515987
complement(2893)-t, cdbSNP:376858768
2894+a, cdbSNP:397515988
2898+a, cdbSNP:121909376
2911+g, tdbSNP:397515989
complement(2915)-t, cdbSNP:373744177
2919..2920+, ctdbSNP:397515990
2925+c, gdbSNP:193922380
complement(2928)-g, adbSNP:376504548
complement(2937)-g, adbSNP:373056282
complement(2941)-t, cdbSNP:369685402
2960+c, tdbSNP:397515992
2969+dbSNP:
2969+c, tdbSNP:193922382
2993+c, tdbSNP:397515994
2998..3002+, gaccadbSNP:397515995
complement(3035)-g, adbSNP:375776406
complement(3052)-dbSNP:
complement(3052)-g, adbSNP:377283955
3058+c, tdbSNP:397515996
3059+c, tdbSNP:3729799
3095+, cdbSNP:397515997
3103+c, tdbSNP:397515998
complement(3104)-t, cdbSNP:368180702
complement(3106)-t, cdbSNP:375552602
complement(3107)-g, cdbSNP:372003333
3119+c, tdbSNP:397515999
3120+a, c, gdbSNP:397516000
3123..3124+, adbSNP:397516001
3138+c, gdbSNP:397516002
complement(3142)-g, adbSNP:201515977
3153+a, gdbSNP:397516003
complement(3157)-g, adbSNP:200663253
complement(3161)-g, adbSNP:61729664
complement(3162)-t, cdbSNP:374255381
complement(3167)-t, cdbSNP:370223247
complement(3171)-t, cdbSNP:368633238
complement(3178)-g, adbSNP:374626656
complement(3192)-g, adbSNP:371061770
3197+c, tdbSNP:11570113
complement(3197)-g, adbSNP:386519587
complement(3223)-g, adbSNP:373208282
3226+a, gdbSNP:397516004
3236+c, tdbSNP:397516005
3247..3248+dbSNP:
3247..3248+, cdbSNP:397516007
complement(3272)-g, adbSNP:368973872
complement(3273)-t, cdbSNP:376598916
complement(3279)-g, cdbSNP:150786409
complement(3280)-c, adbSNP:374289617
3281..3282+, tdbSNP:397516008
complement(3283)-g, adbSNP:369999866
3284+a, gdbSNP:397516009
3288+a, gdbSNP:397516006
3308+g, tdbSNP:397516010
complement(3331)-g, adbSNP:376344765
3334+c, tdbSNP:36212064
3336+a, tdbSNP:397516012
complement(3340)-t, g, cdbSNP:367927327
3341+g, tdbSNP:121909377
3343+a, gdbSNP:1052373
3348+a, gdbSNP:397516013
3352..3353+, gdbSNP:397516014
complement(3352)-t, cdbSNP:371301665
complement(3364)-g, cdbSNP:185428948
complement(3370)-t, gdbSNP:200372325
complement(3371)-t, cdbSNP:377106864
3378+a, cdbSNP:397516015
3381+c, tdbSNP:397516016
complement(3401)-dbSNP:
complement(3401)-c, adbSNP:370952321
complement(3413)-g, adbSNP:368721523
3417+a, gdbSNP:397516018
3428+a, gdbSNP:121909378
complement(3439)-g, cdbSNP:375116558
complement(3447)-g, adbSNP:370890951
3463+a, cdbSNP:193922383
complement(3467)-g, adbSNP:377171707
complement(3468)-t, g, cdbSNP:187705120
complement(3470)-t, cdbSNP:373519667
complement(3497)-t, cdbSNP:370658083
complement(3518)-t, cdbSNP:377352427
complement(3525)-g, adbSNP:373304680
3534..3535+, ttatdbSNP:397516019
complement(3540)-t, cdbSNP:370040023
complement(3553)-dbSNP:
complement(3553)-g, cdbSNP:373620343
complement(3590)-t, cdbSNP:199669878
3603+g, tdbSNP:397516024
complement(3624)-t, cdbSNP:117354682
complement(3628)-t, cdbSNP:371488508
3635+a, gdbSNP:397516026
3640+a, cdbSNP:397516027
3654+c, tdbSNP:397516028
3679..3680+, cdbSNP:397516029
3679+, cdbSNP:397516030
complement(3697)-dbSNP:
complement(3697)-t, cdbSNP:368765949
complement(3709)-g, adbSNP:374755212
complement(3723)-t, cdbSNP:372821359
complement(3727)-g, adbSNP:368221517
3731+c, tdbSNP:397516033
3732+g, tdbSNP:397516034
complement(3737)-g, adbSNP:201312636
3749+a, tdbSNP:397516035
3752+c, tdbSNP:397516037
complement(3754)-t, cdbSNP:200162906
3760+a, gdbSNP:397516036
complement(3770)-t, cdbSNP:267602904
3790+, cdbSNP:397516038
complement(3797)-t, cdbSNP:202147520
3808+c, tdbSNP:397516039
complement(3811)-g, cdbSNP:374760003
3814..3815+, gggggcatctatgtctgcdbSNP:193922384
3822..3824+, ccadbSNP:397516040
complement(3842)-g, adbSNP:370338674
3846+a, g, tdbSNP:397514751
3852+a, gdbSNP:397516041
3866+c, tdbSNP:397516042
complement(3873)-dbSNP:
complement(3873)-g, adbSNP:369184972
complement(3920)-dbSNP:
complement(3920)-g, adbSNP:148237662
complement(3949)-g, adbSNP:11570120
complement(3993)-c, adbSNP:117960173
complement(4110)-, tdbSNP:376645369
complement(4116)-g, adbSNP:11570121
Gene SymbolMYBPC3
Gene SynonymCMD1MM; CMH4; FHC; LVNC10; MYBP-C
Chromosome11
Locus Map11p11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000256 Homo sapiens myosin binding protein C, cardiac (MYBPC3), mRNA. On-demand $1699.00 25
XM_006718238 PREDICTED: Homo sapiens myosin binding protein C, cardiac (MYBPC3), transcript variant X1, mRNA. On-demand $1699.00 25
Title Myocardial infarction-induced N-terminal fragment of cardiac myosin-binding protein C (cMyBP-C) impairs myofilament function in human myocardium .
Author Witayavanitkul N, Ait Mou Y, Kuster DW, Khairallah RJ, Sarkey J, Govindan S, Chen X, Ge Y, Rajan S, Wieczorek DF, Irving T, Westfall MV, de Tombe PP and Sadayappan S.
Journal J. Biol. Chem. 289 (13), 8818-8827 (2014)
Title Release kinetics of circulating cardiac myosin binding protein-C following cardiac injury .
Author Kuster DW, Cardenas-Ospina A, Miller L, Liebetrau C, Troidl C, Nef HM, Mollmann H, Hamm CW, Pieper KS, Mahaffey KW, Kleiman NS, Stuyvers BD, Marian AJ and Sadayappan S.
Journal Am. J. Physiol. Heart Circ. Physiol. 306 (4), H547-H556 (2014)
Title E258K HCM-causing mutation in cardiac MyBP-C reduces contractile force and accelerates twitch kinetics by disrupting the cMyBP-C and myosin S2 interaction .
Author De Lange WJ, Grimes AC, Hegge LF, Spring AM, Brost TM and Ralphe JC.
Journal J. Gen. Physiol. 142 (3), 241-255 (2013)
Title Autosomal recessive transmission of MYBPC3 mutation results in malignant phenotype of hypertrophic cardiomyopathy .
Author Wang Y, Wang Z, Yang Q, Zou Y, Zhang H, Yan C, Feng X, Chen Y, Zhang Y, Wang J, Zhou X, Ahmad F, Hui R and Song L.
Journal PLoS ONE 8 (6), E67087 (2013)
Title Cardiac myosin binding protein-C gene splice acceptor site mutation is associated with familial hypertrophic cardiomyopathy .
Author Bonne G, Carrier L, Bercovici J, Cruaud C, Richard P, Hainque B, Gautel M, Labeit S, James M, Beckmann J, Weissenbach J, Vosberg HP, Fiszman M, Komajda M and Schwartz K.
Journal Nat. Genet. 11 (4), 438-440 (1995)
Title Mutations in the cardiac myosin binding protein-C gene on chromosome 11 cause familial hypertrophic cardiomyopathy .
Author Watkins H, Conner D, Thierfelder L, Jarcho JA, MacRae C, McKenna WJ, Maron BJ, Seidman JG and Seidman CE.
Journal Nat. Genet. 11 (4), 434-437 (1995)
Title Hypertrophic Cardiomyopathy Overview .
Author Cirino,A.L. and Ho,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dilated Cardiomyopathy Overview .
Author Hershberger,R.E. and Morales,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Effect of C-protein on actomyosin ATPase .
Author Moos,C. and Feng,I.N.
Journal Biochim. Biophys. Acta 632 (2), 141-149 (1980)
Title The interaction of C-protein with heavy meromyosin and subfragment-2 .
Author Starr,R. and Offer,G.
Journal Biochem. J. 171 (3), 813-816 (1978)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.