• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, heavy chain 7, cardiac muscle, beta (MYH7), mRNA.


RefSeq Accession Definition Service Stock Status Price *Turnaround time Order
NM_000257 Homo sapiens myosin, heavy chain 7, cardiac muscle, beta (MYH7), mRNA. GenEZ ORF Cloning On-demand $2699.00 30

*Business Day

Related Services

RefSeq Version NM_000257.3, 657940851
Length 6069 bp
Structure linear
Update Date 20-JUN-2014
Organism Homo sapiens (human)
Definition Homo sapiens myosin, heavy chain 7, cardiac muscle, beta (MYH7), mRNA.
Product myosin-7
Comment

Summary: Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy. [provided by RefSeq, Jul 2008].

RefSeq NP_000248.2
CDS 132..5939
Misc Feature(1)102..104
Misc Feature(2)102..104
Misc Feature(3)231..356
Misc Feature(4)231..356
Misc Feature(5)240..4427
Misc Feature(6)372..2462
Misc Feature(7)order(507..518,522..527,669..692)
Misc Feature(8)849..866
Misc Feature(9)1515..1538
Misc Feature(10)order(1599..1634,1641..1670)
Misc Feature(11)2094..2162
Misc Feature(12)2214..2258
Misc Feature(13)order(2253..2258,2265..2267,2283..2285,2292..2297,
Misc Feature(14)2400..2444
Misc Feature(15)2871..>3476
Misc Feature(16)3333..5909
Misc Feature(17)<3525..4010
Misc Feature(18)3825..4403
Misc Feature(19)order(3831..3833,3840..3845,3855..3857,3861..3866,
Translation MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVT AETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGL FCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES GAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDN SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFG NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV IYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMF PKATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDP LNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMT NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ RYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER LSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLL KSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD AEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT LAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL TKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL KKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI QRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA ALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR ENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEASLEHEEGKILR AQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG DLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTE VEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL RAKSRDIGTKGLNEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
Gene SymbolMYH7
Gene SynonymCMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Chromosome14
Locus Map14q12
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000257 Homo sapiens myosin, heavy chain 7, cardiac muscle, beta (MYH7), mRNA. On-demand $2699.00 30
XM_005267697 PREDICTED: Homo sapiens myosin, heavy chain 7, cardiac muscle, beta (MYH7), transcript variant X2, mRNA. On-demand $1699.00 25
Title Genetic variations of beta-MYH7 in Venezuelan patients with hypertrophic cardiomyopathy .
Author Rodriguez,R., Guerrero,D., Rivas,Y., Lacruz,A. and Flores,Y.
Journal Invest Clin 55 (1), 23-31 (2014)
Title The hypertrophic cardiomyopathy myosin mutation R453C alters ATP binding and hydrolysis of human cardiac beta-myosin .
Author Bloemink M, Deacon J, Langer S, Vera C, Combs A, Leinwand L and Geeves MA.
Journal J. Biol. Chem. 289 (8), 5158-5167 (2014)
Title All-atom molecular dynamics simulations of actin-myosin interactions: a comparative study of cardiac alpha myosin, beta myosin, and fast skeletal muscle myosin .
Author Li M and Zheng W.
Journal Biochemistry 52 (47), 8393-8405 (2013)
Title Hereditary myosin myopathies .
Author Oldfors A.
Journal Neuromuscul. Disord. 17 (5), 355-367 (2007)
Title Hypertrophic Cardiomyopathy Overview .
Author Cirino,A.L. and Ho,C.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Laing Distal Myopathy .
Author Lamont,P., Wallefeld,W. and Laing,N.G.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dilated Cardiomyopathy Overview .
Author Hershberger,R.E. and Morales,A.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Congenital Fiber-Type Disproportion .
Author DeChene,E.T., Kang,P.B. and Beggs,A.H.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Dinucleotide repeat polymorphism at the human cardiac beta-myosin heavy chain gene (HMSYHCO1) locus .
Author Warlick CA, Ramachandra S, Mishra S and Donis-Keller H.
Journal Hum. Mol. Genet. 1 (2), 136 (1992)
Title Dinucleotide repeat polymorphism at the human gene for cardiac beta-myosin heavy chain (MYH6) .
Author Fougerousse F, Dufour C, Roudaut C and Beckmann JS.
Journal Hum. Mol. Genet. 1 (1), 64 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.