• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens myosin, heavy chain 7, cardiac muscle, beta (MYH7), mRNA.


RefSeq Accession Definition Services Price Order
NM_000257 Homo sapiens myosin, heavy chain 7, cardiac muscle, beta (MYH7), mRNA. ORF Sequence $2613.60
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000257.2, 115496168
Length 6044 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens myosin, heavy chain 7, cardiac muscle, beta (MYH7), mRNA.
Product myosin-7
Comment

Summary: Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing early-onset distal myopathy. [provided by RefSeq, Jul 2008].

RefSeq NP_000248.2
CDS 107..5914
Misc Feature(1)77..79
Misc Feature(2)206..331
Misc Feature(3)206..331
Misc Feature(4)344..2440
Misc Feature(5)347..2437
Misc Feature(6)order(482..493,497..502,644..667)
Misc Feature(7)824..841
Misc Feature(8)1490..1513
Misc Feature(9)order(1574..1609,1616..1645)
Misc Feature(10)2069..2137
Misc Feature(11)2189..2233
Misc Feature(12)order(2228..2233,2240..2242,2258..2260,2267..2272,
Misc Feature(13)2375..2419
Misc Feature(14)3308..5884
Exon (1)1..98
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (2)99..307
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (3)308..451
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (4)452..608
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (5)609..636
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (6)637..745
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (7)746..838
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (8)839..902
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (9)903..1001
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (10)1002..1105
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (11)1106..1244
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (12)1245..1363
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (13)1364..1513
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (14)1514..1684
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (15)1685..1994
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (16)1995..2062
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (17)2063..2150
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (18)2151..2268
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (19)2269..2392
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (20)2393..2529
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (21)2530..2785
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (22)2786..3028
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (23)3029..3205
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (24)3206..3351
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (25)3352..3442
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (26)3443..3832
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (27)3833..3959
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (28)3960..4078
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (29)4079..4275
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (30)4276..4459
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (31)4460..4625
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (32)4626..4750
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (33)4751..5059
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (34)5060..5263
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (35)5264..5389
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (36)5390..5665
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (37)5666..5761
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (38)5762..5896
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Exon (39)5897..6030
Gene:MYH7
Gene Synonym:CMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Translation MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVT AETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGL FCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES GAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDN SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFG NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV IYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMF PKATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDP LNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMT NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ RYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER LSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLL KSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD AEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT LAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL TKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL KKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI QRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA ALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR ENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEASLEHEEGKILR AQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG DLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTE VEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL RAKSRDIGTKGLNEE
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(45)-dbSNP:
complement(45)-t, cdbSNP:45566639
complement(71)-t, cdbSNP:45497293
complement(99)-dbSNP:
complement(99)-g, adbSNP:45556042
complement(107)-t, cdbSNP:139250539
complement(114)-c, adbSNP:3729993
complement(118)-g, adbSNP:45561941
complement(134)-g, cdbSNP:199577321
complement(155)-t, cdbSNP:45511396
complement(183)-g, adbSNP:186964570
complement(190)-g, cdbSNP:200930470
complement(202)-g, adbSNP:201828336
complement(220)-g, adbSNP:146210693
complement(295)-t, cdbSNP:2069540
complement(346)-dbSNP:
complement(346)-g, adbSNP:200493975
complement(367)-g, adbSNP:148560996
complement(403)-g, adbSNP:140245862
complement(427)-c, adbSNP:2754166
complement(433)-t, cdbSNP:36211408
complement(451)-g, adbSNP:149439730
complement(456)-dbSNP:
complement(456)-t, adbSNP:201012865
complement(502)-t, cdbSNP:138932714
complement(503)-t, cdbSNP:199637885
complement(517)-t, cdbSNP:61977674
complement(580)-g, adbSNP:200444892
complement(586)-t, cdbSNP:45500700
complement(637)-dbSNP:
complement(637)-g, adbSNP:200035152
complement(703..704)-g, adbSNP:36211409
complement(703)-g, adbSNP:2069541
complement(712)-t, gdbSNP:45504196
complement(773)-dbSNP:
complement(773)-g, adbSNP:121913645
complement(815)-t, cdbSNP:45516091
complement(820)-g, adbSNP:202141819
complement(830)-g, adbSNP:113884995
834+a, gdbSNP:267606910
complement(838)-t, cdbSNP:2069542
complement(852)-dbSNP:
complement(852)-g, adbSNP:3218713
complement(873)-g, adbSNP:121913633
complement(987)-dbSNP:
complement(987)-, tdbSNP:35765584
complement(1000)-t, cdbSNP:147062651
complement(1022)-dbSNP:
complement(1022)-t, cdbSNP:201467368
complement(1036)-g, adbSNP:111626355
complement(1081)-t, cdbSNP:2231124
complement(1108)-dbSNP:
complement(1108)-t, cdbSNP:34803781
complement(1152)-t, cdbSNP:121913640
complement(1168)-t, cdbSNP:735712
complement(1189)-g, adbSNP:145091844
complement(1195)-g, adbSNP:2231125
complement(1201)-g, c, adbSNP:735711
complement(1228)-g, adbSNP:1111163
complement(1231)-g, adbSNP:916130
complement(1234)-t, c, adbSNP:2231126
complement(1249)-dbSNP:
complement(1249)-t, adbSNP:146651471
complement(1285)-g, adbSNP:143293426
complement(1297)-t, cdbSNP:139506719
complement(1313)-t, cdbSNP:3218714
complement(1314)-t, g, adbSNP:121913624
complement(1336)-g, adbSNP:150885220
complement(1372)-dbSNP:
complement(1372)-g, adbSNP:141519877
complement(1428)-t, cdbSNP:121913653
complement(1430)-g, adbSNP:148808089
complement(1444)-g, adbSNP:147327560
complement(1459)-t, cdbSNP:144047238
1463+a, c, tdbSNP:121913625
complement(1501)-t, cdbSNP:45508293
complement(1502)-g, cdbSNP:4981473
complement(1504)-t, cdbSNP:188880142
complement(1510)-g, adbSNP:140218676
complement(1513)-g, adbSNP:112172952
complement(1553)-dbSNP:
complement(1553)-g, adbSNP:121913651
1597+g, tdbSNP:267606911
complement(1601)-g, adbSNP:3218715
complement(1612)-g, cdbSNP:3729813
complement(1644)-t, gdbSNP:121913636
complement(1700)-dbSNP:
complement(1700)-t, cdbSNP:121913642
complement(1711)-g, adbSNP:2069543
complement(1777)-t, cdbSNP:149386750
complement(1807)-c, adbSNP:1041954
complement(1840)-g, adbSNP:201393848
complement(1856)-g, cdbSNP:121913626
complement(1861)-t, gdbSNP:201860580
complement(1873)-t, cdbSNP:3729816
complement(1922)-g, adbSNP:121913627
complement(1952)-t, cdbSNP:1041955
complement(1965)-t, adbSNP:199862338
complement(1970)-c, adbSNP:150153771
complement(1992)-g, adbSNP:140824103
complement(2031)-dbSNP:
complement(2031)-t, cdbSNP:121913646
complement(2089)-dbSNP:
complement(2089)-g, adbSNP:146474860
complement(2134)-g, adbSNP:145564868
complement(2146)-g, adbSNP:200980487
complement(2152)-dbSNP:
complement(2152)-g, cdbSNP:1126421
complement(2197)-g, adbSNP:140380523
complement(2224)-t, gdbSNP:3181426
complement(2251)-g, adbSNP:146675572
complement(2252)-g, adbSNP:121913638
complement(2261)-t, cdbSNP:121913637
complement(2262)-g, adbSNP:121913641
complement(2273)-dbSNP:
complement(2273)-t, cdbSNP:121913630
complement(2289)-t, cdbSNP:121913644
complement(2290)-t, g, cdbSNP:148650290
complement(2327)-g, cdbSNP:121913632
complement(2356)-g, adbSNP:144942248
complement(2398)-dbSNP:
complement(2398)-g, cdbSNP:121913643
complement(2411)-t, cdbSNP:45606737
complement(2439)-g, adbSNP:121913634
complement(2440)-t, cdbSNP:2069544
complement(2455)-g, adbSNP:139882431
complement(2464)-t, g, adbSNP:36211714
complement(2465)-g, adbSNP:145677314
complement(2483)-t, gdbSNP:140175704
complement(2495)-g, adbSNP:3218716
complement(2526)-t, cdbSNP:141414377
complement(2588)-dbSNP:
complement(2588)-t, cdbSNP:45526433
complement(2620)-g, adbSNP:45560638
complement(2635)-t, cdbSNP:201131056
complement(2659)-t, gdbSNP:144291282
complement(2678)-g, cdbSNP:2754158
complement(2679)-g, c, adbSNP:2856897
complement(2691)-g, adbSNP:149576470
complement(2692)-c, adbSNP:112677962
complement(2712)-t, cdbSNP:202141173
complement(2714)-g, adbSNP:138049878
complement(2715)-g, adbSNP:36211715
complement(2742)-t, gdbSNP:145417343
complement(2743)-g, adbSNP:199915408
complement(2755)-t, cdbSNP:140434009
complement(2758..2760)-, gaadbSNP:193922387
2823+dbSNP:
2823+a, gdbSNP:267606908
complement(2828)-g, cdbSNP:121913631
complement(2857)-t, cdbSNP:1041957
complement(2872)-t, cdbSNP:138756911
complement(2875)-t, cdbSNP:36211716
complement(2876)-g, adbSNP:121913628
complement(2901)-g, adbSNP:202097576
complement(2909)-g, adbSNP:121913639
complement(2911)-t, cdbSNP:201032556
complement(2932)-g, cdbSNP:2856898
complement(2933)-t, cdbSNP:1041958
complement(2951)-g, adbSNP:121913629
complement(2974)-g, adbSNP:140718120
complement(2996)-g, cdbSNP:45496496
complement(3013)-g, adbSNP:142573531
complement(3015)-t, cdbSNP:45468702
complement(3022)-g, cdbSNP:141191984
complement(3028)-t, cdbSNP:147727900
complement(3051)-dbSNP:
complement(3051)-g, adbSNP:145532615
complement(3064)-g, adbSNP:140244068
complement(3073)-g, adbSNP:7157716
complement(3080)-t, gdbSNP:149840927
complement(3109)-t, cdbSNP:71413987
complement(3142)-g, adbSNP:145379951
complement(3151)-g, adbSNP:150607954
complement(3161)-t, cdbSNP:200714763
complement(3222)-dbSNP:
complement(3222)-t, cdbSNP:199573700
complement(3239)-t, cdbSNP:45611033
complement(3244)-t, cdbSNP:201195256
complement(3259)-g, adbSNP:45540831
complement(3262)-t, cdbSNP:138294643
complement(3314)-t, cdbSNP:137857131
complement(3322)-g, adbSNP:146256500
complement(3341)-g, adbSNP:192722540
complement(3379)-dbSNP:
complement(3379)-g, adbSNP:200664031
complement(3392)-t, gdbSNP:45478699
complement(3443)-dbSNP:
complement(3443)-g, adbSNP:193922388
complement(3455)-c, adbSNP:141735183
complement(3457)-g, adbSNP:45554236
complement(3476)-t, gdbSNP:1041961
complement(3488)-t, cdbSNP:199552354
complement(3508)-t, cdbSNP:61742469
complement(3580)-, gdbSNP:34856803
complement(3583..3584)-, gdbSNP:35187609
complement(3613)-g, cdbSNP:200336193
complement(3670)-t, cdbSNP:45587932
complement(3709)-g, cdbSNP:201576345
complement(3836)-dbSNP:
complement(3836)-t, gdbSNP:200746981
complement(3880)-t, cdbSNP:199653953
complement(3883)-g, adbSNP:149103761
complement(3887)-c, adbSNP:193922389
complement(3892)-g, adbSNP:45497796
complement(3895)-t, cdbSNP:137918672
complement(3907)-g, cdbSNP:200000290
complement(3958)-t, cdbSNP:45565337
complement(3967)-dbSNP:
complement(3967)-g, cdbSNP:150292548
complement(3970)-g, cdbSNP:45501694
complement(3971)-g, adbSNP:180824037
complement(3994)-g, adbSNP:3729819
complement(4024)-g, adbSNP:144420313
complement(4066)-t, cdbSNP:147797612
complement(4087)-dbSNP:
complement(4087)-t, gdbSNP:141764279
complement(4099)-g, adbSNP:200288088
complement(4111)-t, cdbSNP:144465613
complement(4171)-g, adbSNP:142469226
complement(4181)-t, cdbSNP:45451303
complement(4183)-t, cdbSNP:45523835
complement(4190)-t, adbSNP:112771600
complement(4294)-dbSNP:
complement(4294)-t, cdbSNP:200852418
complement(4333)-g, cdbSNP:148788346
complement(4345)-g, adbSNP:3729821
complement(4346)-t, gdbSNP:201895208
complement(4364)-g, adbSNP:145213771
complement(4381)-g, adbSNP:57680382
complement(4399)-t, cdbSNP:45560242
complement(4400)-t, cdbSNP:144200285
complement(4453)-g, adbSNP:182311329
complement(4478)-dbSNP:
complement(4478)-g, cdbSNP:190577943
complement(4483)-c, adbSNP:201307101
complement(4529)-g, adbSNP:139646545
complement(4558)-g, adbSNP:61737803
complement(4562)-t, cdbSNP:200855376
complement(4578)-g, cdbSNP:3729823
complement(4604)-t, cdbSNP:45544633
complement(4605)-t, g, cdbSNP:121913647
complement(4606)-t, cdbSNP:199995198
complement(4619)-g, adbSNP:139928934
complement(4663)-dbSNP:
complement(4663)-g, adbSNP:150552664
complement(4672)-g, adbSNP:2754155
complement(4693)-g, adbSNP:148054271
complement(4762)-dbSNP:
complement(4762)-c, adbSNP:143471552
complement(4766)-g, cdbSNP:142694139
complement(4777)-t, cdbSNP:200601164
complement(4778)-t, adbSNP:201326686
complement(4779)-c, adbSNP:200593263
complement(4813)-c, adbSNP:199557822
complement(4822)-g, adbSNP:7140196
complement(4831)-g, adbSNP:45476496
complement(4846)-g, adbSNP:201469051
complement(4894)-t, cdbSNP:146858930
complement(4912)-g, adbSNP:142034311
complement(4921)-t, cdbSNP:202026847
complement(4922)-g, adbSNP:200530211
complement(4955..4957)-, aagdbSNP:121913648
complement(4961)-g, adbSNP:45442096
complement(5010)-g, adbSNP:145822086
complement(5014)-g, adbSNP:150241539
complement(5015)-t, cdbSNP:141122361
complement(5017)-g, adbSNP:151113658
complement(5086)-dbSNP:
complement(5086)-t, g, cdbSNP:112943492
complement(5111)-t, gdbSNP:45620235
complement(5122)-t, gdbSNP:2754153
complement(5125)-g, adbSNP:139518691
complement(5177)-g, adbSNP:45464193
complement(5202)-t, cdbSNP:146778113
complement(5212)-g, adbSNP:3729830
complement(5240)-t, cdbSNP:121913650
complement(5241)-g, adbSNP:193922390
complement(5269)-dbSNP:
complement(5269)-g, adbSNP:148739072
5292..5294+, agadbSNP:367543052
complement(5309)-t, adbSNP:144066768
complement(5335)-c, adbSNP:149509691
complement(5349)-t, cdbSNP:200303340
5402+dbSNP:
5402+a, gdbSNP:267606909
complement(5411)-t, gdbSNP:139222507
complement(5435)-t, cdbSNP:200939753
complement(5467)-t, cdbSNP:201171029
complement(5484)-t, cdbSNP:121913654
complement(5503)-t, cdbSNP:200374977
complement(5518)-g, cdbSNP:147433856
complement(5527)-t, gdbSNP:142844109
complement(5529)-g, cdbSNP:45594737
complement(5557)-g, cdbSNP:138682220
complement(5564)-g, cdbSNP:145734640
complement(5590)-g, adbSNP:202175645
complement(5591)-t, cdbSNP:143562243
complement(5595)-t, cdbSNP:113137192
complement(5600)-g, c, adbSNP:201865159
complement(5605)-t, cdbSNP:3729831
complement(5606)-t, cdbSNP:143362532
complement(5625)-g, adbSNP:149193520
complement(5633)-t, cdbSNP:200157204
complement(5639)-t, cdbSNP:28933098
complement(5642)-g, c, adbSNP:12590294
complement(5694)-dbSNP:
complement(5694)-g, adbSNP:45520836
complement(5753)-g, adbSNP:121913652
complement(5808)-t, adbSNP:121913649
complement(5809)-g, cdbSNP:45570635
complement(5810)-g, cdbSNP:187073962
complement(5824)-c, adbSNP:45523233
complement(5831)-t, gdbSNP:146796870
complement(5842)-g, adbSNP:200728597
complement(5845)-g, adbSNP:200921000
complement(5860)-g, adbSNP:138110910
complement(5899)-dbSNP:
complement(5899)-g, adbSNP:148420672
5913+a, gdbSNP:367543053
complement(5920)-t, gdbSNP:15808
complement(5934)-g, adbSNP:45548631
complement(6019)-g, adbSNP:200550717
complement(6027)-t, cdbSNP:17794387
complement(6029)-t, g, cdbSNP:112019745
Gene SymbolMYH7
Gene SynonymCMD1S; CMH1; MPD1; MYHCB; SPMD; SPMM
Chromosome14
Locus Map14q12
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000257 Homo sapiens myosin, heavy chain 7, cardiac muscle, beta (MYH7), mRNA. Full Length $2719.80
ORF Sequence $2613.60
Title Resequencing the whole MYH7 gene (including the intronic, promoter, and 3' UTR sequences) in hypertrophic cardiomyopathy .
Author Coto,E., Reguero,J.R., Palacin,M., Gomez,J., Alonso,B., Iglesias,S., Martin,M., Tavira,B., Diaz-Molina,B., Morales,C., Moris,C., Rodriguez-Lambert,J.L., Corao,A.I., Diaz,M. and Alvarez,V.
Journal J Mol Diagn 14 (5), 518-524 (2012)
Title New phenotype and pathology features in MYH7-related distal myopathy .
Author Tasca,G., Ricci,E., Penttila,S., Monforte,M., Giglio,V., Ottaviani,P., Camastra,G., Silvestri,G. and Udd,B.
Journal Neuromuscul. Disord. 22 (7), 640-647 (2012)
Title A low prevalence of MYH7/MYBPC3 mutations among familial hypertrophic cardiomyopathy patients in India .
Author Bashyam,M.D., Purushotham,G., Chaudhary,A.K., Rao,K.M., Acharya,V., Mohammad,T.A., Nagarajaram,H.A., Hariram,V. and Narasimhan,C.
Journal Mol. Cell. Biochem. 360 (1-2), 373-382 (2012)
Title beta-myosin heavy chain is induced by pressure overload in a minor subpopulation of smaller mouse cardiac myocytes .
Author Lopez,J.E., Myagmar,B.E., Swigart,P.M., Montgomery,M.D., Haynam,S., Bigos,M., Rodrigo,M.C. and Simpson,P.C.
Journal Circ. Res. 109 (6), 629-638 (2011)
Title [Mutation analysis of beta myosin heavy chain gene in hypertrophic cardiomyopathy families] .
Author Fan,X.P., Yang,Z.W., Feng,X.L., Yang,F.H., Xiao,B. and Liang,Y.
Journal Zhonghua Yi Xue Yi Chuan Xue Za Zhi 28 (4), 387-392 (2011)
Title Hereditary myosin myopathies .
Author Oldfors,A.
Journal Neuromuscul. Disord. 17 (5), 355-367 (2007)
Title Novel missense mutation in cardiac beta myosin heavy chain gene found in a Japanese patient with hypertrophic cardiomyopathy .
Author Nishi,H., Kimura,A., Harada,H., Toshima,H. and Sasazuki,T.
Journal Biochem. Biophys. Res. Commun. 188 (1), 379-387 (1992)
Title Dinucleotide repeat polymorphism at the human cardiac beta-myosin heavy chain gene (HMSYHCO1) locus .
Author Warlick,C.A., Ramachandra,S., Mishra,S. and Donis-Keller,H.
Journal Hum. Mol. Genet. 1 (2), 136 (1992)
Title Dinucleotide repeat polymorphism at the human gene for cardiac beta-myosin heavy chain (MYH6) .
Author Fougerousse,F., Dufour,C., Roudaut,C. and Beckmann,J.S.
Journal Hum. Mol. Genet. 1 (1), 64 (1992)
Title An estimate of the sequencing error frequency in the DNA sequence databases .
Author Kristensen,T., Lopez,R. and Prydz,H.
Journal DNA Seq. 2 (6), 343-346 (1992)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878