• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens peptidase D (PEPD), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu24790 Homo sapiens peptidase D (PEPD), transcript variant 1, mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu24790C Homo sapiens peptidase D (PEPD), transcript variant 1, mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000285.3, 260593661
Length 1482 bp
Structure linear
Update Date 17-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens peptidase D (PEPD), transcript variant 1, mRNA.
Product xaa-Pro dipeptidase isoform 1
Comment

Summary: This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009].


Transcript Variant: This variant (1) represents the longest transcript and encodes the longest isoform (1).

RefSeq NP_000276.2
CDS 134..1615
Misc Feature(1)113..115
Misc Feature(2)137..139
Misc Feature(3)137..139
Misc Feature(4)185..598
Misc Feature(5)212..1576
Misc Feature(6)707..1534
Misc Feature(7)order(896..898,959..961,992..994,1241..1243,1367..1369,
Exon (1)1..150
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (2)151..334
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (3)335..462
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (4)463..526
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (5)527..574
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (6)575..636
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (7)637..681
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (8)682..757
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (9)758..804
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (10)805..873
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (11)874..951
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (12)952..1100
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (13)1101..1285
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (14)1286..1477
Gene:PEPD
Gene Synonym:PROLIDASE
Exon (15)1478..2010
Gene:PEPD
Gene Synonym:PROLIDASE
Translation MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTD TGVLFRQESFFHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEK YAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEI VECRVFKTDMELEVLRYTNKISSEAHREVMKAVKVGMKEYELESLFEHYCYSRGGMRHSS YTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGEYYCFASDITCSFPANGKFTA DQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLG AVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH LLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMA GCDKAFTPFSGPK
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(67)-dbSNP:
complement(67)-g, adbSNP:370425595
complement(129)-g, adbSNP:368370973
complement(157)-dbSNP:
complement(157)-t, cdbSNP:374014841
complement(165..166)-, cdbSNP:35641847
complement(167)-t, cdbSNP:201992066
complement(189)-g, adbSNP:377085952
complement(195)-g, adbSNP:199711203
complement(213)-t, cdbSNP:372527759
complement(230)-g, adbSNP:61734503
complement(231)-t, cdbSNP:187269138
complement(233)-g, adbSNP:376016676
complement(236)-g, adbSNP:185183225
complement(237)-t, cdbSNP:200435937
complement(266)-t, cdbSNP:369878645
complement(285)-t, cdbSNP:199892951
complement(310)-g, adbSNP:372913336
complement(316..317)-, cdbSNP:34004641
complement(329)-g, adbSNP:368995247
complement(347)-dbSNP:
complement(347)-g, cdbSNP:201752816
complement(355)-t, cdbSNP:200108299
complement(366)-g, cdbSNP:186203899
complement(381)-t, cdbSNP:376397947
complement(391)-g, adbSNP:371699437
complement(392)-t, cdbSNP:201865747
complement(411)-g, adbSNP:375348295
complement(416)-g, adbSNP:202186183
complement(484)-dbSNP:
complement(484)-t, gdbSNP:374573875
complement(499)-t, gdbSNP:201145610
complement(505)-g, adbSNP:371364077
complement(506)-t, cdbSNP:377429945
complement(535)-dbSNP:
complement(535)-g, adbSNP:373639982
complement(543)-g, adbSNP:188930796
complement(544)-t, cdbSNP:370221183
complement(558)-g, adbSNP:375915358
complement(575)-dbSNP:
complement(575)-g, adbSNP:61734505
complement(580)-g, adbSNP:375023206
complement(585)-t, cdbSNP:368559424
complement(589)-t, cdbSNP:200011486
complement(595)-g, adbSNP:375631938
complement(619..620)-, adbSNP:35524700
complement(625)-g, adbSNP:370105932
complement(633)-t, cdbSNP:61734506
complement(640)-dbSNP:
complement(640)-g, cdbSNP:377714630
complement(642)-t, adbSNP:61748998
complement(644)-g, cdbSNP:368784737
complement(667)-t, cdbSNP:376361050
complement(674)-g, cdbSNP:372629704
complement(683)-dbSNP:
complement(683)-g, adbSNP:375391662
684+a, gdbSNP:121917722
complement(696)-g, adbSNP:141623136
complement(699)-t, cdbSNP:151278946
complement(719)-g, adbSNP:368647287
complement(720)-t, cdbSNP:374162516
738+c, tdbSNP:267606943
complement(793)-dbSNP:
complement(793)-g, adbSNP:3745969
complement(804)-c, adbSNP:377738544
complement(820)-dbSNP:
complement(820)-g, cdbSNP:369525071
complement(825)-t, cdbSNP:375061486
complement(830)-g, adbSNP:371953949
complement(836)-t, cdbSNP:200871513
complement(868)-g, adbSNP:199612179
complement(869)-t, cdbSNP:368547324
complement(877)-dbSNP:
complement(877)-g, adbSNP:74988985
complement(884)-t, adbSNP:201572375
complement(886)-t, adbSNP:190681033
complement(889)-g, adbSNP:374710449
complement(890)-t, cdbSNP:200450538
complement(901)-g, adbSNP:149406115
complement(908)-t, cdbSNP:370370158
complement(912)-t, cdbSNP:376338457
926+c, tdbSNP:121917725
complement(927..928)-, adbSNP:35226114
complement(927)-t, cdbSNP:200351927
complement(943)-t, cdbSNP:79755990
complement(947)-t, cdbSNP:199794147
959+dbSNP:
959+a, gdbSNP:121917721
complement(962)-t, adbSNP:374795227
966+a, gdbSNP:121917723
complement(967)-g, adbSNP:371699300
complement(974)-t, adbSNP:367902648
complement(991)-g, adbSNP:375354020
complement(992)-t, cdbSNP:201584435
complement(996)-g, adbSNP:139214756
complement(1003)-g, adbSNP:375514363
complement(1019)-t, cdbSNP:370970279
1045..1046+, gccdbSNP:185359328
complement(1045)-g, adbSNP:199621901
complement(1046)-t, cdbSNP:200931112
1065+g, tdbSNP:1063319
complement(1074)-t, cdbSNP:201447445
complement(1079)-t, cdbSNP:370219399
complement(1100)-t, cdbSNP:375919385
1104+dbSNP:
1104+a, tdbSNP:1140312
complement(1106)-g, adbSNP:371556469
complement(1117)-g, adbSNP:368959300
complement(1124)-g, adbSNP:376817734
complement(1195)-t, cdbSNP:372210606
complement(1212)-t, cdbSNP:201089253
complement(1216)-g, adbSNP:201975796
complement(1227)-g, adbSNP:200183031
complement(1231)-g, adbSNP:149579451
complement(1255)-g, adbSNP:370399053
complement(1259)-t, cdbSNP:374603111
complement(1264)-t, g, cdbSNP:17569
complement(1265)-t, cdbSNP:367841505
1296+dbSNP:
1296+a, gdbSNP:2230062
complement(1301)-c, adbSNP:377199331
complement(1311)-c, adbSNP:377536201
1367+a, gdbSNP:267606944
complement(1372)-t, cdbSNP:373060916
complement(1389)-t, cdbSNP:142070498
complement(1414)-t, cdbSNP:183038027
complement(1427)-t, cdbSNP:149042427
1436+c, tdbSNP:17570
complement(1441)-g, adbSNP:368792538
complement(1442)-g, adbSNP:376372688
complement(1443)-t, cdbSNP:373297406
complement(1444)-g, adbSNP:369197590
complement(1445)-t, cdbSNP:376211407
complement(1450)-g, adbSNP:369183873
1462+c, tdbSNP:2230063
complement(1464)-t, cdbSNP:371934154
complement(1466)-c, adbSNP:368651528
1475+a, gdbSNP:121917724
complement(1484)-dbSNP:
complement(1484)-t, cdbSNP:377685056
complement(1499)-t, cdbSNP:189549581
complement(1507)-c, adbSNP:199999333
complement(1518)-g, adbSNP:201222933
complement(1547)-t, cdbSNP:200072143
complement(1566)-g, cdbSNP:372530277
complement(1575)-c, adbSNP:144944440
complement(1588)-g, adbSNP:375224388
complement(1596)-g, cdbSNP:200567073
complement(1635)-t, gdbSNP:369236384
complement(1655)-t, adbSNP:375067721
1667+c, tdbSNP:1061338
complement(1668)-g, adbSNP:77690463
1742+a, gdbSNP:149914845
complement(1786..1787)-, ttaadbSNP:79486519
complement(1786..1787)-, ttaadbSNP:398071183
complement(1793..1794)-, taatdbSNP:16426
1822+c, g, tdbSNP:1038
1826+c, tdbSNP:3556
complement(1847)-g, cdbSNP:34742162
complement(1869)-t, cdbSNP:140038783
complement(1942..1946)-, tcagadbSNP:201816618
complement(1946..1947)-, aagtadbSNP:398120965
complement(1951..1952)-, aaagt, aagtadbSNP:10659604
complement(1952..1953)-, aaagtdbSNP:140842
complement(1993)-g, cdbSNP:185823037
Gene SymbolPEPD
Gene SynonymPROLIDASE
Chromosome19
Locus Map19q13.11
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000285 Homo sapiens peptidase D (PEPD), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_000285 Homo sapiens peptidase D (PEPD), transcript variant 1, mRNA. In-stock $99.00 5-7
NM_000285 Homo sapiens peptidase D (PEPD), transcript variant 1, mRNA. In-stock $99.00 5-7
Title A meta-analysis of genome-wide association studies for adiponectin levels in East Asians identifies a novel locus near WDR11-FGFR2 .
Author Wu Y, Gao H, Li H, Tabara Y, Nakatochi M, Chiu YF, Park EJ, Wen W, Adair LS, Borja JB, Cai Q, Chang YC, Chen P, Croteau-Chonka DC, Fogarty MP, Gan W, He CT, Hsiung CA, Hwu CM, Ichihara S, Igase M, Jo J, Kato N, Kawamoto R, Kuzawa CW, Lee JJ, Liu J, Lu L, McDade TW, Osawa H, Sheu WH, Teo Y, Vadlamudi S, Van Dam RM, Wang Y, Xiang YB, Yamamoto K, Ye X, Young TL, Zheng W, Zhu J, Shu XO, Shin C, Jee SH, Chuang LM, Miki T, Yokota M, Lin X, Mohlke KL and Tai ES.
Journal Hum. Mol. Genet. 23 (4), 1108-1119 (2014)
Title Discovery and refinement of loci associated with lipid levels .
Author Willer CJ, Schmidt EM, Sengupta S, Peloso GM, Gustafsson S, Kanoni S, Ganna A, Chen J, Buchkovich ML, Mora S, Beckmann JS, Bragg-Gresham JL, Chang HY, Demirkan A, Den Hertog HM, Do R, Donnelly LA, Ehret GB, Esko T, Feitosa MF, Ferreira T, Fischer K, Fontanillas P, Fraser RM, Freitag DF, Gurdasani D, Heikkila K, Hypponen E, Isaacs A, Jackson AU, Johansson A, Johnson T, Kaakinen M, Kettunen J, Kleber ME, Li X, Luan J, Lyytikainen LP, Magnusson PK, Mangino M, Mihailov E, Montasser ME, Muller-Nurasyid M, Nolte IM, O'Connell JR, Palmer CD, Perola M, Petersen AK, Sanna S, Saxena R, Service SK, Shah S, Shungin D, Sidore C, Song C, Strawbridge RJ, Surakka I, Tanaka T, Teslovich TM, Thorleifsson G, Van den Herik EG, Voight BF, Volcik KA, Waite LL, Wong A, Wu Y, Zhang W, Absher D, Asiki G, Barroso I, Been LF, Bolton JL, Bonnycastle LL, Brambilla P, Burnett MS, Cesana G, Dimitriou M, Doney AS, Doring A, Elliott P, Epstein SE, Eyjolfsson GI, Gigante B, Goodarzi MO, Grallert H, Gravito ML, Groves CJ, Hallmans G, Hartikainen AL, Hayward C, Hernandez D, Hicks AA, Holm H, Hung YJ, Illig T, Jones MR, Kaleebu P, Kastelein JJ, Khaw KT, Kim E, Klopp N, Komulainen P, Kumari M, Langenberg C, Lehtimaki T, Lin SY, Lindstrom J, Loos RJ, Mach F, McArdle WL, Meisinger C, Mitchell BD, Muller G, Nagaraja R, Narisu N, Nieminen TV, Nsubuga RN, Olafsson I, Ong KK, Palotie A, Papamarkou T, Pomilla C, Pouta A, Rader DJ, Reilly MP, Ridker PM, Rivadeneira F, Rudan I, Ruokonen A, Samani N, Scharnagl H, Seeley J, Silander K, Stancakova A, Stirrups K, Swift AJ, Tiret L, Uitterlinden AG, van Pelt LJ, Vedantam S, Wainwright N, Wijmenga C, Wild SH, Willemsen G, Wilsgaard T, Wilson JF, Young EH, Zhao JH, Adair LS, Arveiler D, Assimes TL, Bandinelli S, Bennett F, Bochud M, Boehm BO, Boomsma DI, Borecki IB, Bornstein SR, Bovet P, Burnier M, Campbell H, Chakravarti A, Chambers JC, Chen YD, Collins FS, Cooper RS, Danesh J, Dedoussis G, de Faire U, Feranil AB, Ferrieres J, Ferrucci L, Freimer NB, Gieger C, Groop LC, Gudnason V, Gyllensten U, Hamsten A, Harris TB, Hingorani A, Hirschhorn JN, Hofman A, Hovingh GK, Hsiung CA, Humphries SE, Hunt SC, Hveem K, Iribarren C, Jarvelin MR, Jula A, Kahonen M, Kaprio J, Kesaniemi A, Kivimaki M, Kooner JS, Koudstaal PJ, Krauss RM, Kuh D, Kuusisto J, Kyvik KO, Laakso M, Lakka TA, Lind L, Lindgren CM, Martin NG, Marz W, McCarthy MI, McKenzie CA, Meneton P, Metspalu A, Moilanen L, Morris AD, Munroe PB, Njolstad I, Pedersen NL, Power C, Pramstaller PP, Price JF, Psaty BM, Quertermous T, Rauramaa R, Saleheen D, Salomaa V, Sanghera DK, Saramies J, Schwarz PE, Sheu WH, Shuldiner AR, Siegbahn A, Spector TD, Stefansson K, Strachan DP, Tayo BO, Tremoli E, Tuomilehto J, Uusitupa M, van Duijn CM, Vollenweider P, Wallentin L, Wareham NJ, Whitfield JB, Wolffenbuttel BH, Ordovas JM, Boerwinkle E, Palmer CN, Thorsteinsdottir U, Chasman DI, Rotter JI, Franks PW, Ripatti S, Cupples LA, Sandhu MS, Rich SS, Boehnke M, Deloukas P, Kathiresan S, Mohlke KL, Ingelsson E and Abecasis GR.
Journal Nat. Genet. 45 (11), 1274-1283 (2013)
Title Fibrosis in heart failure subtypes .
Author Toprak G, Yuksel H, Demirpence O, Islamoglu Y, Evliyaoglu O and Mete N.
Journal Eur Rev Med Pharmacol Sci 17 (17), 2302-2309 (2013)
Title The effect of estrogen on prolidase-dependent regulation of HIF-1alpha expression in breast cancer cells .
Author Surazynski A, Miltyk W, Prokop I and Palka J.
Journal Mol. Cell. Biochem. 379 (1-2), 29-36 (2013)
Title Four novel PEPD alleles causing prolidase deficiency .
Author Ledoux P, Scriver C and Hechtman P.
Journal Am. J. Hum. Genet. 54 (6), 1014-1021 (1994)
Title Structural organization of the gene for human prolidase (peptidase D) and demonstration of a partial gene deletion in a patient with prolidase deficiency .
Author Tanoue A, Endo F and Matsuda I.
Journal J. Biol. Chem. 265 (19), 11306-11311 (1990)
Title A single nucleotide change in the prolidase gene in fibroblasts from two patients with polypeptide positive prolidase deficiency. Expression of the mutant enzyme in NIH 3T3 cells .
Author Tanoue A, Endo F, Kitano A and Matsuda I.
Journal J. Clin. Invest. 86 (1), 351-355 (1990)
Title Prolidase deficiency: biochemical classification of alleles .
Author Boright AP, Scriver CR, Lancaster GA and Choy F.
Journal Am. J. Hum. Genet. 44 (5), 731-740 (1989)
Title Primary structure and gene localization of human prolidase .
Author Endo F, Tanoue A, Nakai H, Hata A, Indo Y, Titani K and Matsuda I.
Journal J. Biol. Chem. 264 (8), 4476-4481 (1989)
Title Three-point linkage analysis employing C3 and 19cen markers assigns the myotonic dystrophy gene to 19q .
Author Friedrich,U., Brunner,H., Smeets,D., Lambermon,E. and Ropers,H.H.
Journal Hum. Genet. 75 (3), 291-293 (1987)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.