• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu18889 Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA. pcDNA3.1+-DYK On-demand $1699.00 25
OHu18889C Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA. Customized vector On-demand $1699.00 25

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000292.2, 169790834
Length 3708 bp
Structure linear
Update Date 03-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA.
Product phosphorylase b kinase regulatory subunit alpha, liver isoform
Comment

Summary: Phosphorylase kinase is a polymer of 16 subunits, four each of alpha, beta, gamma and delta. The alpha subunit includes the skeletal muscle and hepatic isoforms, and the hepatic isoform is encoded by this gene. The beta subunit is the same in both the muscle and hepatic isoforms, and encoded by one gene. The gamma subunit also includes the skeletal muscle and hepatic isoforms, which are encoded by two different genes. The delta subunit is a calmodulin and can be encoded by three different genes. The gamma subunits contain the active site of the enzyme, whereas the alpha and beta subunits have regulatory functions controlled by phosphorylation. The delta subunit mediates the dependence of the enzyme on calcium concentration. Mutations in this gene cause glycogen storage disease type 9A, also known as X-linked liver glycogenosis. Alternatively spliced transcript variants have been reported, but the full-length nature of these variants has not been determined.[provided by RefSeq, Feb 2010].

RefSeq NP_000283.1
CDS 431..4138
Misc Feature(1)335..337
Misc Feature(2)452..>1747
Misc Feature(3)452..>1747
Misc Feature(4)2615..2617
Misc Feature(5)2633..2635
Misc Feature(6)2633..2635
Misc Feature(7)<2834..3187
Misc Feature(8)2849..2941
Misc Feature(9)3473..3475
Misc Feature(10)3605..3727
Exon (1)1..508
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (2)509..667
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (3)668..715
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (4)716..884
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (5)885..967
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (6)968..1048
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (7)1049..1147
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (8)1148..1294
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (9)1295..1348
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (10)1349..1471
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (11)1472..1567
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (12)1568..1675
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (13)1676..1754
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (14)1755..1889
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (15)1890..1999
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (16)2000..2144
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (17)2145..2223
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (18)2224..2393
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (19)2394..2567
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (20)2568..2656
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (21)2657..2790
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (22)2791..2947
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (23)2948..3027
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (24)3028..3106
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (25)3107..3236
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (26)3237..3338
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (27)3339..3457
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (28)3458..3487
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (29)3488..3541
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (30)3542..3712
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (31)3713..3766
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (32)3767..3967
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Exon (33)3968..5325
Gene:PHKA2
Gene Synonym:GSD9A; PHK; PYK; PYKL; XLG; XLG2
Translation MRSRSNSGVRLDGYARLVQQTILCYQNPVTGLLSASHEQKDAWVRDNIYSILAVWGLGMA YRKNADRDEDKAKAYELEQNVVKLMRGLLQCMMRQVAKVEKFKHTQSTKDSLHAKYNTAT CGTVVGDDQWGHLQVDATSLFLLFLAQMTASGLRIIFTLDEVAFIQNLVFYIEAAYKVAD YGMWERGDKTNQGIPELNASSVGMAKAALEAIDELDLFGAHGGRKSVIHVLPDEVEHCQS ILFSMLPRASTSKEIDAGLLSIISFPAFAVEDVNLVNVTKNEIISKLQGRYGCCRFLRDG YKTPREDPNRLHYDPAELKLFENIECEWPVFWTYFIIDGVFSGDAVQVQEYREALEGILI RGKNGIRLVPELYAVPPNKVDEEYKNPHTVDRVPMGKVPHLWGQSLYILSSLLAEGFLAA GEIDPLNRRFSTSVKPDVVVQVTVLAENNHIKDLLRKHGVNVQSIADIHPIQVQPGRILS HIYAKLGRNKNMNLSGRPYRHIGVLGTSKLYVIRNQIFTFTPQFTDQHHFYLALDNEMIV EMLRIELAYLCTCWRMTGRPTLTFPISRTMLTNDGSDIHSAVLSTIRKLEDGYFGGARVK LGNLSEFLTTSFYTYLTFLDPDCDEKLFDNASEGTFSPDSDSDLVGYLEDTCNQESQDEL DHYINHLLQSTSLRSYLPPLCKNTEDRHVFSAIHSTRDILSVMAKAKGLEVPFVPMTLPT KVLSAHRKSLNLVDSPQPLLEKVPESDFQWPRDDHGDVDCEKLVEQLKDCSNLQDQADIL YILYVIKGPSWDTNLSGQHGVTVQNLLGELYGKAGLNQEWGLIRYISGLLRKKVEVLAEA CTDLLSHQKQLTVGLPPEPREKIISAPLPPEELTKLIYEASGQDISIAVLTQEIVVYLAM YVRAQPSLFVEMLRLRIGLIIQVMATELARSLNCSGEEASESLMNLSPFDMKNLLHHILS GKEFGVERSVRPIHSSTSSPTISIHEVGHTGVTKTERSGINRLRSEMKQMTRRFSADEQF FSVGQAASSSAHSSKSARSSTPSSPTGTSSSDSGGHHIGWGERQGQWLRRRRLDGAINRV PVGFYQRVWKILQKCHGLSIDGYVLPSSTTREMTPHEIKFAVHVESVLNRVPQPEYRQLL VEAIMVLTLLSDTEMTSIGGIIHVDQIVQMASQLFLQDQVSIGAMDTLEKDQATGICHFF YDSAPSGAYGTMTYLTRAVASYLQELLPNSGCQMQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(197)-dbSNP:
complement(197)-c, adbSNP:367705180
complement(407)-g, adbSNP:186848251
complement(434)-g, cdbSNP:140014925
complement(467)-t, cdbSNP:202065000
complement(497)-g, cdbSNP:144220206
complement(499)-g, cdbSNP:369826720
complement(514)-dbSNP:
complement(514)-g, adbSNP:149538323
complement(542)-g, cdbSNP:17313469
complement(562)-t, cdbSNP:61733285
complement(614)-g, adbSNP:201643189
complement(615)-t, cdbSNP:201526300
complement(619)-t, cdbSNP:367727274
complement(685)-dbSNP:
complement(685)-t, cdbSNP:371539484
complement(711)-t, cdbSNP:201186865
complement(712)-t, cdbSNP:113429755
complement(725)-dbSNP:
complement(725)-t, cdbSNP:200281934
complement(743)-t, cdbSNP:199595540
complement(769)-g, adbSNP:142799459
complement(784)-g, adbSNP:201548823
complement(823)-g, adbSNP:377351016
824+c, tdbSNP:137852292
825+a, cdbSNP:137852291
complement(844)-t, gdbSNP:373400606
complement(877)-t, g, adbSNP:145847640
complement(902)-dbSNP:
complement(902)-t, cdbSNP:142034171
complement(907)-g, adbSNP:187396860
complement(914)-t, cdbSNP:200454257
complement(944)-t, cdbSNP:147985423
986+dbSNP:
986+c, tdbSNP:137852294
987+a, gdbSNP:137852290
995+a, gdbSNP:137852295
complement(1015)-t, cdbSNP:143424727
complement(1151)-dbSNP:
complement(1151)-t, cdbSNP:367696431
complement(1172)-t, gdbSNP:149219369
complement(1215)-c, adbSNP:145406549
complement(1228)-t, cdbSNP:373857042
complement(1279)-t, adbSNP:61733284
complement(1299)-dbSNP:
complement(1299)-t, cdbSNP:186632999
1326+a, gdbSNP:137852289
complement(1393)-dbSNP:
complement(1393)-g, adbSNP:35010660
complement(1411)-t, cdbSNP:370976236
complement(1420)-t, cdbSNP:146825403
complement(1501)-dbSNP:
complement(1501)-t, cdbSNP:372850698
complement(1550)-t, cdbSNP:143722795
complement(1558)-t, cdbSNP:140060022
complement(1582)-dbSNP:
complement(1582)-g, adbSNP:372560098
complement(1645)-g, adbSNP:368320508
complement(1649)-g, adbSNP:151036725
complement(1662)-g, adbSNP:191688140
complement(1668)-g, adbSNP:377163221
complement(1676)-dbSNP:
complement(1676)-t, cdbSNP:16980929
complement(1738)-c, adbSNP:148492015
complement(1763)-dbSNP:
complement(1763)-g, adbSNP:200298889
complement(1774)-g, adbSNP:183426079
complement(1776)-t, cdbSNP:370432175
complement(1793)-g, adbSNP:199949166
complement(1807)-t, cdbSNP:148314029
complement(1825)-g, adbSNP:368111963
complement(1826)-t, cdbSNP:144591812
complement(1827)-g, adbSNP:191267737
complement(1828)-t, cdbSNP:146631734
complement(1855)-t, cdbSNP:374029800
complement(1858)-g, adbSNP:370668371
complement(1859)-g, adbSNP:376233279
complement(1886)-g, adbSNP:140527678
complement(1923)-dbSNP:
complement(1923)-g, adbSNP:199792389
complement(1987)-g, adbSNP:143533978
complement(1991)-t, cdbSNP:137958637
complement(1996)-g, cdbSNP:372872986
complement(2005)-dbSNP:
complement(2005)-g, adbSNP:372736260
complement(2009)-g, cdbSNP:17856445
complement(2020)-t, cdbSNP:2662851
complement(2042)-t, cdbSNP:141146446
complement(2048)-t, cdbSNP:368594655
complement(2062)-t, cdbSNP:201710031
complement(2065)-g, cdbSNP:148176463
complement(2066)-t, cdbSNP:200073285
complement(2085)-g, adbSNP:145880509
complement(2087)-g, adbSNP:140703161
complement(2100)-g, cdbSNP:201183167
complement(2125)-g, adbSNP:201064777
complement(2169)-dbSNP:
complement(2169)-g, adbSNP:371660303
complement(2186)-t, cdbSNP:368319311
complement(2188)-g, adbSNP:146853190
complement(2197)-t, cdbSNP:148153758
complement(2199)-t, cdbSNP:374430401
complement(2205)-t, cdbSNP:370965746
complement(2244)-dbSNP:
complement(2244)-g, adbSNP:181796565
complement(2263)-t, cdbSNP:149176629
complement(2326)-g, adbSNP:139852230
complement(2345)-c, adbSNP:376198886
complement(2351)-t, cdbSNP:373701207
complement(2357)-g, cdbSNP:369400689
complement(2382)-t, gdbSNP:149991825
complement(2387)-t, gdbSNP:377629807
complement(2440)-dbSNP:
complement(2440)-g, adbSNP:186124510
complement(2507)-t, cdbSNP:143732206
complement(2518)-t, cdbSNP:151240321
complement(2576)-dbSNP:
complement(2576)-t, cdbSNP:151174788
complement(2591)-t, cdbSNP:368123691
complement(2597)-g, adbSNP:2662852
complement(2602)-g, adbSNP:144151433
2607+a, cdbSNP:2640033
complement(2609)-g, adbSNP:188998010
complement(2633)-c, adbSNP:199904295
complement(2642)-g, adbSNP:147193649
complement(2645)-g, adbSNP:368431458
complement(2674)-dbSNP:
complement(2674)-g, adbSNP:143626269
complement(2687)-t, cdbSNP:148440259
complement(2696)-t, cdbSNP:17851089
complement(2701)-g, adbSNP:201428825
complement(2709)-t, cdbSNP:144488245
2726+c, tdbSNP:137852286
complement(2742)-g, adbSNP:370591245
complement(2774)-t, cdbSNP:149252917
complement(2795)-dbSNP:
complement(2795)-g, adbSNP:138395800
complement(2806)-g, adbSNP:376764779
complement(2827)-g, adbSNP:181179616
complement(2834)-t, cdbSNP:144581707
complement(2866)-t, cdbSNP:61733281
complement(2872)-g, adbSNP:139012270
complement(2892)-t, cdbSNP:373884791
complement(2946)-t, cdbSNP:113232696
complement(2952)-dbSNP:
complement(2952)-t, cdbSNP:374894621
complement(2962)-t, cdbSNP:61729452
complement(2987)-t, c, adbSNP:184537378
complement(2998)-c, adbSNP:141034910
complement(3004)-t, cdbSNP:368415466
complement(3008)-g, adbSNP:375687463
complement(3076)-dbSNP:
complement(3076)-t, cdbSNP:148120527
complement(3095)-t, cdbSNP:199948654
complement(3100)-g, adbSNP:143721284
complement(3177)-dbSNP:
complement(3177)-t, cdbSNP:370190347
complement(3219)-t, cdbSNP:201611776
complement(3232)-g, cdbSNP:148945763
complement(3265)-dbSNP:
complement(3265)-g, adbSNP:374818894
complement(3340)-dbSNP:
complement(3340)-t, cdbSNP:147879086
complement(3342)-t, cdbSNP:376405603
complement(3374)-t, cdbSNP:371896006
complement(3384)-t, adbSNP:368331679
complement(3386)-t, cdbSNP:144570979
3455+c, tdbSNP:137852285
complement(3460)-dbSNP:
complement(3460)-t, cdbSNP:374834944
complement(3503)-dbSNP:
complement(3503)-g, cdbSNP:61733286
complement(3505)-t, cdbSNP:369190118
complement(3509)-t, cdbSNP:142314331
complement(3510)-g, adbSNP:375184186
complement(3531)-g, adbSNP:199905459
complement(3550)-dbSNP:
complement(3550)-g, adbSNP:147638986
complement(3562)-t, cdbSNP:376018294
3576+a, cdbSNP:137852287
complement(3605)-t, cdbSNP:145264064
complement(3613)-c, adbSNP:201989887
complement(3617)-t, gdbSNP:139136352
complement(3673)-g, adbSNP:150764699
complement(3674)-t, cdbSNP:142123423
complement(3691)-t, cdbSNP:373845304
complement(3715)-dbSNP:
complement(3715)-g, adbSNP:183285231
complement(3716)-g, adbSNP:148627941
complement(3717)-t, cdbSNP:61731574
complement(3719)-t, cdbSNP:145952475
complement(3739)-g, adbSNP:142339696
complement(3743)-g, adbSNP:139033266
complement(3762)-t, cdbSNP:374245493
3771+dbSNP:
3771+c, tdbSNP:137852293
complement(3775)-t, cdbSNP:201620564
complement(3818)-g, adbSNP:368131175
complement(3823)-g, cdbSNP:146146284
complement(3826)-t, cdbSNP:374048049
complement(3832)-g, adbSNP:149632860
complement(3845)-g, adbSNP:371835709
complement(3847)-t, cdbSNP:138280296
complement(3905)-t, cdbSNP:374443475
complement(3939)-g, adbSNP:150445034
complement(3974)-dbSNP:
complement(3974)-t, cdbSNP:201884669
complement(3991)-t, gdbSNP:377355086
complement(4028)-g, adbSNP:200054284
complement(4031)-g, adbSNP:373407231
complement(4039)-g, adbSNP:141588752
4044+c, tdbSNP:137852288
complement(4045)-t, g, cdbSNP:200550207
complement(4047)-g, cdbSNP:374881210
complement(4063)-t, cdbSNP:372415141
complement(4120)-c, adbSNP:369001472
complement(4135)-t, cdbSNP:112249974
complement(4140)-t, cdbSNP:374849324
complement(4142)-g, cdbSNP:201847825
complement(4151)-t, adbSNP:371654294
complement(4156)-t, adbSNP:368335914
complement(4161)-t, cdbSNP:202246833
complement(4170)-t, gdbSNP:376602692
complement(4179)-t, cdbSNP:375034922
complement(4230)-t, cdbSNP:147641162
complement(4319..4320)-, tctadbSNP:369242600
complement(4331)-g, adbSNP:185981642
complement(4411)-g, adbSNP:372416461
complement(4446)-g, adbSNP:181609896
complement(4786)-t, cdbSNP:374494359
4817+c, tdbSNP:145313253
complement(4879)-t, cdbSNP:77481942
complement(4880)-t, cdbSNP:74651426
complement(4914..4915)-, aacdbSNP:375963066
complement(4942)-t, cdbSNP:6653642
complement(4946)-g, cdbSNP:56141038
complement(4995)-g, adbSNP:372735275
complement(5077)-g, adbSNP:142176794
complement(5240)-t, cdbSNP:11094760
complement(5281..5282)-, cdbSNP:34953688
Gene SymbolPHKA2
Gene SynonymGSD9A; PHK; PYK; PYKL; XLG; XLG2
ChromosomeX
Locus MapXp22.2-p22.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000292 Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA. On-demand $1699.00 25
NM_000292 Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA. On-demand $1699.00 25
NM_000292 Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA. On-demand $1699.00 25
NM_000292 Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA. On-demand $1699.00 25
NM_000292 Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA. On-demand $1699.00 25
NM_000292 Homo sapiens phosphorylase kinase, alpha 2 (liver) (PHKA2), mRNA. On-demand $1699.00 25
Title Glycogen storage disease type IX: novel PHKA2 missense mutation and cirrhosis .
Author Johnson AO, Goldstein JL and Bali D.
Journal J. Pediatr. Gastroenterol. Nutr. 55 (1), 90-92 (2012)
Title Common mutation in the PHKA2 gene with variable phenotype in patients with liver phosphorylase b kinase deficiency .
Author Achouitar S, Goldstein JL, Mohamed M, Austin S, Boyette K, Blanpain FM, Rehder CW, Kishnani PS, Wortmann SB, den Heijer M, Lefeber DJ, Wevers RA, Bali DS and Morava E.
Journal Mol. Genet. Metab. 104 (4), 691-694 (2011)
Title Novel mutations in PHKA2 gene in glycogen storage disease type IX patients from Hong Kong, China .
Author Lau CK, Hui J, Fong FN, To KF, Fok TF, Tang NL and Tsui SK.
Journal Mol. Genet. Metab. 102 (2), 222-225 (2011)
Title 3D mapping of glycogenosis-causing mutations in the large regulatory alpha subunit of phosphorylase kinase .
Author Carriere C, Jonic S, Mornon JP and Callebaut I.
Journal Biochim. Biophys. Acta 1782 (11), 664-670 (2008)
Title Glycogen storage disease type IX: High variability in clinical phenotype .
Author Beauchamp NJ, Dalton A, Ramaswami U, Niinikoski H, Mention K, Kenny P, Kolho KL, Raiman J, Walter J, Treacy E, Tanner S and Sharrard M.
Journal Mol. Genet. Metab. 92 (1-2), 88-99 (2007)
Title Phosphorylase Kinase Deficiency .
Author Goldstein,J., Austin,S., Kishnani,P. and Bali,D.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title cDNA cloning of a liver isoform of the phosphorylase kinase alpha subunit and mapping of the gene to Xp22.2-p22.1, the region of human X-linked liver glycogenosis .
Author Davidson JJ, Ozcelik T, Hamacher C, Willems PJ, Francke U and Kilimann MW.
Journal Proc. Natl. Acad. Sci. U.S.A. 89 (6), 2096-2100 (1992)
Title Regional mapping of a liver alpha-subunit gene of phosphorylase kinase (PHKA) to the distal region of human chromosome Xp .
Author Wauters JG, Bossuyt PJ, Davidson J, Hendrickx J, Kilimann MW and Willems PJ.
Journal Cytogenet. Cell Genet. 60 (3-4), 194-196 (1992)
Title Families with X-linked liver glycogenosis due to phosphorylase kinase deficiency .
Author Willems,P.
Journal Clin. Genet. 38 (1), 80 (1990)
Title The natural history of liver glycogenosis due to phosphorylase kinase deficiency: a longitudinal study of 41 patients .
Author Willems PJ, Gerver WJ, Berger R and Fernandes J.
Journal Eur. J. Pediatr. 149 (4), 268-271 (1990)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.