• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens polycystic kidney disease 2 (autosomal dominant) (PKD2), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu26897 Homo sapiens polycystic kidney disease 2 (autosomal dominant) (PKD2), mRNA. pcDNA3.1+-DYK On-demand TBD TBD
OHu26897C Homo sapiens polycystic kidney disease 2 (autosomal dominant) (PKD2), mRNA. Customized vector On-demand $329.00 TBD

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000297.3, 325121002
Length 2907 bp
Structure linear
Update Date 25-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens polycystic kidney disease 2 (autosomal dominant) (PKD2), mRNA.
Product polycystin-2
Comment

Summary: This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. This protein interacts with polycystin 1, and they may be partners in a common signaling cascade involved in tubular morphogenesis. Mutations in this gene are associated with autosomal dominant polycystic kidney disease type 2. [provided by RefSeq, Mar 2011].

RefSeq NP_000288.1
CDS 88..2994
Misc Feature(1)28..30
Misc Feature(2)28..30
Misc Feature(3)583..585
Misc Feature(4)583..585
Misc Feature(5)757..819
Misc Feature(6)886..2148
Misc Feature(7)1033..1071
Misc Feature(8)1492..1554
Misc Feature(9)1603..1665
Misc Feature(10)1738..1800
Misc Feature(11)1882..1944
Misc Feature(12)2062..2124
Misc Feature(13)2197..2469
Misc Feature(14)2281..2421
Misc Feature(15)order(2284..2286,2305..2307,2374..2376,2380..2382,
Misc Feature(16)2494..2553
Misc Feature(17)2521..2523
Misc Feature(18)2569..2991
Exon (1)1..682
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (2)683..796
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (3)797..930
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (4)931..1181
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (5)1182..1406
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (6)1407..1635
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (7)1636..1803
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (8)1804..1985
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (9)1986..2106
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (10)2107..2205
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (11)2206..2327
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (12)2328..2445
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (13)2446..2609
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (14)2610..2757
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Exon (15)2758..5079
Gene:PKD2
Gene Synonym:APKD2; Pc-2; PC2; PKD4; TRPP2
Translation MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIR QAAARDPPAGAAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRP GSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPL EGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYG MMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQ TEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTR ATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIF CFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLE DQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGF AIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIY FTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKN TVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRD DLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQ VLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEI HREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGG NGSSNVHV
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
170+c, gdbSNP:1805044
392..393+, gagdbSNP:398122932
448+g, tdbSNP:371898195
complement(507)-t, cdbSNP:2728118
531+c, tdbSNP:181704860
655+a, gdbSNP:117078377
691+dbSNP:
691+a, gdbSNP:139121831
740+a, cdbSNP:376416017
799+dbSNP:
799+a, tdbSNP:145910596
820+a, cdbSNP:200543024
821+a, gdbSNP:376108991
839+a, gdbSNP:147000344
871+a, gdbSNP:138132026
893+a, gdbSNP:201632217
935+dbSNP:
935+c, tdbSNP:200759509
960+c, gdbSNP:368654947
979+a, gdbSNP:200912883
985+c, gdbSNP:142118986
995+c, gdbSNP:374751939
1003+a, cdbSNP:200001068
1032+a, gdbSNP:201789789
1038+g, tdbSNP:368513916
1052+a, gdbSNP:145877597
1053+g, tdbSNP:138446087
1081+g, tdbSNP:200314088
1122+c, tdbSNP:113818977
1144+a, gdbSNP:375164861
1179+c, tdbSNP:149257723
1191+dbSNP:
1191+c, tdbSNP:376697740
1201+a, gdbSNP:188394492
1226+a, gdbSNP:121918039
1235+c, tdbSNP:144431856
1300+c, tdbSNP:121918041
1310+g, tdbSNP:148386297
1337+a, gdbSNP:142261953
1359+c, tdbSNP:373170198
1368+a, tdbSNP:367859449
1413+dbSNP:
1413+g, tdbSNP:367862195
1433+g, tdbSNP:1131408
1441+a, gdbSNP:1801612
1446+a, gdbSNP:17013754
1476+a, cdbSNP:139700679
1477+c, tdbSNP:121918042
1478+a, gdbSNP:144390370
1486+a, gdbSNP:202245969
1531+g, tdbSNP:201504575
1532+g, tdbSNP:75762896
1546+c, tdbSNP:201328200
1564+c, tdbSNP:139753109
1604+c, tdbSNP:149780942
1610+a, gdbSNP:373937061
1619+a, tdbSNP:121918043
1629+c, tdbSNP:145716012
1633+g, tdbSNP:143581690
1642+dbSNP:
1642+a, gdbSNP:148920907
1651+a, cdbSNP:374402854
1674+a, tdbSNP:375543446
1704+c, gdbSNP:145297759
1721+c, tdbSNP:147630070
1732+c, gdbSNP:377454143
1741+c, gdbSNP:369908107
1811+dbSNP:
1811+a, gdbSNP:181037821
1812+a, gdbSNP:370049694
1820+a, gdbSNP:373742634
1917+a, gdbSNP:144968710
1923+c, tdbSNP:145952917
1956+c, gdbSNP:148228357
1980+a, gdbSNP:140182728
1989+dbSNP:
1989+c, tdbSNP:368390451
1991+c, gdbSNP:150314615
1993+a, cdbSNP:398123307
1995+a, gdbSNP:112589618
2013+c, tdbSNP:186866404
2018+c, tdbSNP:137929700
2035+a, gdbSNP:142303714
2046+c, tdbSNP:371979633
2047+a, cdbSNP:146396414
2054+g, tdbSNP:138476749
2072+c, tdbSNP:142983796
2129+dbSNP:
2129+a, gdbSNP:199723110
2221+dbSNP:
2221+c, tdbSNP:73841280
2226+c, tdbSNP:200707583
2268+a, gdbSNP:201367641
2292+a, gdbSNP:368245083
2309+c, tdbSNP:372274184
2311+c, tdbSNP:121918040
2332+dbSNP:
2332+a, gdbSNP:148761063
2333..2334+, cdbSNP:34640972
2359+a, gdbSNP:375848428
2382+c, tdbSNP:138982773
2391+a, gdbSNP:369078169
2427+c, tdbSNP:372745575
2428+a, gdbSNP:142360839
2479+dbSNP:
2479+c, tdbSNP:150838063
2485+a, cdbSNP:2234917
2486+c, tdbSNP:376271163
2498+a, gdbSNP:145343957
2507+a, gdbSNP:147654263
2533+a, gdbSNP:377704618
2535+c, tdbSNP:371289455
2573+a, gdbSNP:140589899
2578+c, tdbSNP:149728995
2581+a, gdbSNP:145574534
2586+c, tdbSNP:180709531
2587+a, gdbSNP:148869484
2620+dbSNP:
2620+c, tdbSNP:369678636
2630+a, gdbSNP:201598917
2650+a, gdbSNP:373306069
2657+c, tdbSNP:375160482
2658+a, gdbSNP:200515044
2670+c, tdbSNP:369520452
2673+c, tdbSNP:373043298
2698+a, gdbSNP:377463048
2724+a, gdbSNP:371249995
2747+c, gdbSNP:374581874
2774+dbSNP:
2774+a, gdbSNP:143500495
2801+c, tdbSNP:373039260
2807+a, gdbSNP:150947109
2812+a, gdbSNP:140848008
2815+c, gdbSNP:377398357
2816+c, gdbSNP:144590958
2842+a, gdbSNP:370489860
2867+a, cdbSNP:374072424
2879+c, tdbSNP:368926162
2886+a, gdbSNP:202049732
2889+a, cdbSNP:375655071
2916+c, tdbSNP:138495345
2920+c, tdbSNP:200394279
2924+c, tdbSNP:370039125
2925+a, gdbSNP:373794310
2950+a, gdbSNP:200131001
2953+a, gdbSNP:142701912
3000+a, gdbSNP:202219511
3026+a, tdbSNP:190600838
complement(3042)-t, gdbSNP:78188174
3065+a, gdbSNP:182182080
3123..3125+, tctdbSNP:372855713
3168+g, tdbSNP:187001642
3221..3222+, adbSNP:200938134
3233+g, tdbSNP:147418332
complement(3250)-g, adbSNP:2728121
3269+c, gdbSNP:111532876
3378+c, tdbSNP:192342290
3546+a, gdbSNP:139787413
3598+a, gdbSNP:377022187
3768+c, gdbSNP:182440735
3788+a, cdbSNP:370387859
3831+c, gdbSNP:77638442
3928+g, tdbSNP:77924334
3951+a, tdbSNP:143594425
4004+a, gdbSNP:144024108
complement(4024)-t, cdbSNP:2725202
4114+c, tdbSNP:116540621
4146+c, tdbSNP:367711189
4170+g, tdbSNP:148672429
4191+c, tdbSNP:142871124
4231+a, gdbSNP:10965
4339+, adbSNP:201035787
4372+a, gdbSNP:370472461
4466..4467+, cdbSNP:34636451
4808+a, gdbSNP:186735575
4820+a, tdbSNP:189817187
4991+c, tdbSNP:375324508
4994+a, g, tdbSNP:182468664
5026+a, cdbSNP:151074095
Gene SymbolPKD2
Gene SynonymAPKD2; Pc-2; PC2; PKD4; TRPP2
Chromosome4
Locus Map4q22.1
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000297 Homo sapiens polycystic kidney disease 2 (autosomal dominant) (PKD2), mRNA. On-demand TBD TBD
Title Novel PKD1 and PKD2 mutations in Taiwanese patients with autosomal dominant polycystic kidney disease .
Author Chang MY, Chen HM, Jenq CC, Lee SY, Chen YM, Tian YC, Chen YC, Hung CC, Fang JT, Yang CW and Wu-Chou YH.
Journal J. Hum. Genet. 58 (11), 720-727 (2013)
Title Reduced ciliary polycystin-2 in induced pluripotent stem cells from polycystic kidney disease patients with PKD1 mutations .
Author Freedman BS, Lam AQ, Sundsbak JL, Iatrino R, Su X, Koon SJ, Wu M, Daheron L, Harris PC, Zhou J and Bonventre JV.
Journal J. Am. Soc. Nephrol. 24 (10), 1571-1586 (2013)
Title Phosphorylation of C-terminal polycystin-2 influences the interaction with PIGEA14: a QCM study based on solid supported membranes .
Author Morick D, Schatz M, Hubrich R, Hoffmeister H, Krefft A, Witzgall R and Steinem C.
Journal Biochem. Biophys. Res. Commun. 437 (4), 532-537 (2013)
Title Polycystin-2 induces a conformational change in polycystin-1 .
Author Oatley P, Talukder MM, Stewart AP, Sandford R and Edwardson JM.
Journal Biochemistry 52 (31), 5280-5287 (2013)
Title PKD1 interacts with PKD2 through a probable coiled-coil domain .
Author Qian F, Germino FJ, Cai Y, Zhang X, Somlo S and Germino GG.
Journal Nat. Genet. 16 (2), 179-183 (1997)
Title A gene similar to PKD1 maps to chromosome 4q22: a candidate gene for PKD2 .
Author Schneider MC, Rodriguez AM, Nomura H, Zhou J, Morton CC, Reeders ST and Weremowicz S.
Journal Genomics 38 (1), 1-4 (1996)
Title PKD2, a gene for polycystic kidney disease that encodes an integral membrane protein .
Author Mochizuki T, Wu G, Hayashi T, Xenophontos SL, Veldhuisen B, Saris JJ, Reynolds DM, Cai Y, Gabow PA, Pierides A, Kimberling WJ, Breuning MH, Deltas CC, Peters DJ and Somlo S.
Journal Science 272 (5266), 1339-1342 (1996)
Title Chromosome 4 localization of a second gene for autosomal dominant polycystic kidney disease .
Author Peters DJ, Spruit L, Saris JJ, Ravine D, Sandkuijl LA, Fossdal R, Boersma J, van Eijk R, Norby S and Constantinou-Deltas CD.
Journal Nat. Genet. 5 (4), 359-362 (1993)
Title Congenital Hepatic Fibrosis Overview .
Author Gunay-Aygun,M., Gahl,W.A. and Heller,T.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)
Title Polycystic Kidney Disease, Autosomal Dominant .
Author Harris,P.C. and Torres,V.E.
Journal (in) Pagon RA, Adam MP, Ardinger HH, Bird TD, Dolan CR, Fong CT, Smith RJH and Stephens K (Eds.); GENEREVIEWS(R); (1993)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.