• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens plasminogen (PLG), transcript variant 1, mRNA.


RefSeq Accession Definition Services Price Order
NM_000301 Homo sapiens plasminogen (PLG), transcript variant 1, mRNA. ORF Sequence $705.57
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000301.3, 270132869
Length 3538 bp
Structure linear
Update Date 21-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens plasminogen (PLG), transcript variant 1, mRNA.
Product plasminogen isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasmin dissolves fibrin in blood clots and is an important protease in many other cellular processes while angiostatin inhibits angiogenesis. Defects in this gene are likely a cause of thrombophilia and ligneous conjunctivitis. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000292.1
CDS 113..2545
Misc Feature(1)53..55
Misc Feature(2)53..55
Misc Feature(3)167..169
Misc Feature(4)167..169
Misc Feature(5)<287..403
Misc Feature(6)344..349
Misc Feature(7)344..346
Misc Feature(8)398..400
Misc Feature(9)398..400
Misc Feature(10)398..400
Misc Feature(11)413..658
Misc Feature(12)446..448
Misc Feature(13)order(491..493,521..523,599..601,605..607,629..631)
Misc Feature(14)656..898
Misc Feature(15)order(674..676,1058..1060)
Misc Feature(16)692..694
Misc Feature(17)order(737..739,767..769,842..844,848..850,872..874)
Misc Feature(18)914..916
Misc Feature(19)926..1171
Misc Feature(20)962..964
Misc Feature(21)order(1007..1009,1037..1039,1112..1114,1118..1120,
Misc Feature(22)1034..1036
Misc Feature(23)1205..1207
Misc Feature(24)1235..1477
Misc Feature(25)1268..1270
Misc Feature(26)order(1313..1315,1343..1345,1418..1420,1424..1426,
Misc Feature(27)1484..1486
Misc Feature(28)1505..1507
Misc Feature(29)1508..1513
Misc Feature(30)1508..1510
Misc Feature(31)1508..1510
Misc Feature(32)1544..1795
Misc Feature(33)order(1553..1555,1790..1792)
Misc Feature(34)1580..1582
Misc Feature(35)order(1616..1618,1739..1741)
Misc Feature(36)order(1625..1627,1658..1660,1736..1738,1742..1744,
Misc Feature(37)order(1703..1705,1775..1777)
Misc Feature(38)1757..1759
Misc Feature(39)1799..1801
Misc Feature(40)order(2165..2167,1811..1813)
Misc Feature(41)order(1865..1867,1841..1843)
Misc Feature(42)1850..1855
Misc Feature(43)1850..1852
Misc Feature(44)1850..1852
Misc Feature(45)1853..2524
Misc Feature(46)1853..1855
Misc Feature(47)1901..1903
Misc Feature(48)1901..1903
Misc Feature(49)order(1976..1978,2105..2107,2390..2392)
Misc Feature(50)2012..2014
Misc Feature(51)2120..2122
Misc Feature(52)2150..2152
Misc Feature(53)2261..2263
Misc Feature(54)2291..2293
Misc Feature(55)order(2372..2374,2447..2449,2453..2455)
Exon (1)1..161
Gene:PLG
Gene Synonym:PLG
Exon (2)162..297
Gene:PLG
Gene Synonym:PLG
Exon (3)298..404
Gene:PLG
Gene Synonym:PLG
Exon (4)405..519
Gene:PLG
Gene Synonym:PLG
Exon (5)520..659
Gene:PLG
Gene Synonym:PLG
Exon (6)660..780
Gene:PLG
Gene Synonym:PLG
Exon (7)781..899
Gene:PLG
Gene Synonym:PLG
Exon (8)900..1062
Gene:PLG
Gene Synonym:PLG
Exon (9)1063..1208
Gene:PLG
Gene Synonym:PLG
Exon (10)1209..1368
Gene:PLG
Gene Synonym:PLG
Exon (11)1369..1550
Gene:PLG
Gene Synonym:PLG
Exon (12)1551..1699
Gene:PLG
Gene Synonym:PLG
Exon (13)1700..1793
Gene:PLG
Gene Synonym:PLG
Exon (14)1794..1914
Gene:PLG
Gene Synonym:PLG
Exon (15)1915..1989
Gene:PLG
Gene Synonym:PLG
Exon (16)1990..2130
Gene:PLG
Gene Synonym:PLG
Exon (17)2131..2237
Gene:PLG
Gene Synonym:PLG
Exon (18)2238..2383
Gene:PLG
Gene Synonym:PLG
Exon (19)2384..3538
Gene:PLG
Gene Synonym:PLG
Translation MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
74+c, tdbSNP:187896045
78+a, gdbSNP:4252060
124+a, gdbSNP:4252061
175+dbSNP:
175+a, gdbSNP:4063623
211+g, tdbSNP:140570408
224+a, gdbSNP:73015965
227+a, cdbSNP:138353396
247+c, tdbSNP:1049571
249+g, tdbSNP:1049573
280+c, tdbSNP:144100362
281+a, gdbSNP:4252070
311+dbSNP:
311+c, tdbSNP:140789621
372+a, gdbSNP:139053275
376+a, gdbSNP:189824042
378+a, gdbSNP:143079629
412+dbSNP:
412+c, tdbSNP:61731705
418+c, gdbSNP:144747470
425+a, gdbSNP:148659959
428+g, tdbSNP:141284301
442+c, tdbSNP:4757
453+c, tdbSNP:139357983
510+a, gdbSNP:61731706
511+a, cdbSNP:4252186
515+c, tdbSNP:199833895
571+dbSNP:
571+a, gdbSNP:144153702
580+a, cdbSNP:146415258
584+a, gdbSNP:141045811
588+c, tdbSNP:201792453
605+c, tdbSNP:139828885
617+a, cdbSNP:143256245
626+a, gdbSNP:145535174
693+dbSNP:
693+a, tdbSNP:150072546
694+c, tdbSNP:145192723
710+a, gdbSNP:149145958
734+g, tdbSNP:201014517
767+c, tdbSNP:151092364
803..805+dbSNP:
803..805+, aagdbSNP:121918034
816+a, gdbSNP:121918030
823+c, tdbSNP:200226472
832+a, gdbSNP:142604256
850+a, cdbSNP:146910079
855+c, tdbSNP:139012522
870+a, gdbSNP:143034754
883+c, tdbSNP:14224
884+a, gdbSNP:138242513
894+a, gdbSNP:4252187
967+dbSNP:
967+a, gdbSNP:202061577
1054+c, tdbSNP:1130656
1073+dbSNP:
1073+a, gdbSNP:76192728
1127+a, gdbSNP:200604924
1135+a, tdbSNP:138051887
1136+a, gdbSNP:199771790
1139+c, tdbSNP:142647215
1183+a, gdbSNP:146041064
1187+a, gdbSNP:201973253
1195+a, gdbSNP:13231
1232+dbSNP:
1232+g, tdbSNP:121918028
1236+a, gdbSNP:142086839
1334+c, tdbSNP:4252119
1371+dbSNP:
1371+a, gdbSNP:139071351
1393+a, gdbSNP:149909079
1449..1450+, gdbSNP:36089164
1470+a, tdbSNP:1804181
1492+a, tdbSNP:116573785
1497+c, tdbSNP:142565890
1526+a, gdbSNP:4252125
1543+c, tdbSNP:4699
1547+g, tdbSNP:121918032
1570+dbSNP:
1570+a, g, tdbSNP:141539231
1581+a, gdbSNP:140537724
1593+c, tdbSNP:4252128
1611+c, tdbSNP:140970354
1615+a, tdbSNP:150227219
1631+g, tdbSNP:138011858
1679+c, tdbSNP:4252129
1768+dbSNP:
1768+c, tdbSNP:113153850
1769+a, gdbSNP:182937977
1834+dbSNP:
1834+a, gdbSNP:146030266
1847+a, gdbSNP:138728014
1875+a, gdbSNP:202141531
1876+c, tdbSNP:201308812
1883+c, tdbSNP:121918029
1960+dbSNP:
1960+a, gdbSNP:121918031
1964+c, tdbSNP:4252195
1970+a, gdbSNP:121918027
1981+c, tdbSNP:144424879
2047+dbSNP:
2047+c, tdbSNP:182180648
2052+c, tdbSNP:187157735
2053+a, c, gdbSNP:61731712
2074+g, tdbSNP:4252196
2138+dbSNP:
2138+a, gdbSNP:142551860
2139+a, tdbSNP:17857492
2157+a, tdbSNP:147175166
2194+c, tdbSNP:4252170
2195+a, gdbSNP:181030365
2198+c, gdbSNP:144869703
2199+a, gdbSNP:147930532
2204+a, gdbSNP:201323384
2246+dbSNP:
2246+a, gdbSNP:202074006
2271+a, gdbSNP:200731501
2296+a, gdbSNP:140580870
2304+a, gdbSNP:150065136
2306+c, tdbSNP:145177652
2307+a, gdbSNP:149148300
2361+c, tdbSNP:138277465
2363+a, gdbSNP:121918033
2371+c, tdbSNP:4252175
2398+dbSNP:
2398+g, tdbSNP:11060
2414+a, gdbSNP:199619244
2468+c, tdbSNP:200857824
2552+a, gdbSNP:181878511
2590+c, tdbSNP:6690
2593+a, gdbSNP:150437480
2666+c, tdbSNP:41267833
2716+c, gdbSNP:140323614
2830+a, tdbSNP:201911710
2830+, tdbSNP:4252177
2835+, adbSNP:200319086
2877+a, cdbSNP:145476240
2899+c, gdbSNP:186439505
2918+a, gdbSNP:189281351
2956+c, tdbSNP:117330062
3031+a, gdbSNP:783169
3040+c, tdbSNP:181010511
3046+c, tdbSNP:783168
3061+c, tdbSNP:185993564
3082+a, gdbSNP:4252178
3110+c, tdbSNP:783167
3142+a, c, tdbSNP:1050912
3176+a, gdbSNP:147387427
3200+a, cdbSNP:139573422
3299+a, gdbSNP:111899543
3320+a, gdbSNP:4252179
3323+c, gdbSNP:11902
3326+a, gdbSNP:4252180
3328+a, gdbSNP:115406365
3385+c, tdbSNP:4252199
3403+a, cdbSNP:139942589
3421+c, tdbSNP:183109765
3456+c, tdbSNP:4252181
3531+c, tdbSNP:4252182
Gene SymbolPLG
Gene SynonymPLG
Chromosome6
Locus Map6q26
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000301 Homo sapiens plasminogen (PLG), transcript variant 1, mRNA. Full Length $1238.30
ORF Sequence $705.57
NM_001168338 Homo sapiens plasminogen (PLG), transcript variant 2, mRNA. Full Length $348.00
ORF Sequence $159.00
Title Spontaneous metastasis in congenic mice with transgenic breast cancer is unaffected by plasminogen gene ablation .
Author Almholt,K., Juncker-Jensen,A., Laerum,O.D., Johnsen,M., Romer,J. and Lund,L.R.
Journal Clin. Exp. Metastasis 30 (3), 277-288 (2013)
Title Serum-derived plasminogen is activated by apoptotic cells and promotes their phagocytic clearance .
Author Rosenwald,M., Koppe,U., Keppeler,H., Sauer,G., Hennel,R., Ernst,A., Blume,K.E., Peter,C., Herrmann,M., Belka,C., Schulze-Osthoff,K., Wesselborg,S. and Lauber,K.
Journal J. Immunol. 189 (12), 5722-5728 (2012)
Title Dihydrolipoamide dehydrogenase of Pseudomonas aeruginosa is a surface-exposed immune evasion protein that binds three members of the factor H family and plasminogen .
Author Hallstrom,T., Morgelin,M., Barthel,D., Raguse,M., Kunert,A., Hoffmann,R., Skerka,C. and Zipfel,P.F.
Journal J. Immunol. 189 (10), 4939-4950 (2012)
Title The serine protease plasmin triggers expression of the CC-chemokine ligand 20 in dendritic cells via Akt/NF-kappaB-dependent pathways .
Author Li,X., Syrovets,T. and Simmet,T.
Journal J. Biomed. Biotechnol. 2012, 186710 (2012)
Title Staphylococcus aureus proteins Sbi and Efb recruit human plasmin to degrade complement C3 and C3b .
Author Koch,T.K., Reuter,M., Barthel,D., Bohm,S., van den Elsen,J., Kraiczy,P., Zipfel,P.F. and Skerka,C.
Journal PLoS ONE 7 (10), E47638 (2012)
Title Chemical evidence that proteolytic cleavage causes the heterogeneity present in human ceruloplasmin preparations .
Author Kingston,I.B., Kingston,B.L. and Putnam,F.W.
Journal Proc. Natl. Acad. Sci. U.S.A. 74 (12), 5377-5381 (1977)
Title Primary structure of the B-chain of human plasmin .
Author Wiman,B.
Journal Eur. J. Biochem. 76 (1), 129-137 (1977)
Title Isolation and characterization of alpha2-plasmin inhibitor from human plasma. A novel proteinase inhibitor which inhibits activator-induced clot lysis .
Author Moroi,M. and Aoki,N.
Journal J. Biol. Chem. 251 (19), 5956-5965 (1976)
Title Amino-acid sequence of the cyanogen-bromide fragment from human plasminogen that forms the linkage between the plasmin chains .
Author Wiman,B. and Wallen,P.
Journal Eur. J. Biochem. 58 (2), 539-547 (1975)
Title Structural relationship between 'glutamic acid' and 'lysine' forms of human plasminogen and their interaction with the NH2-terminal activation peptide as studied by affinity chromatography .
Author Wiman,B. and Wallen,P.
Journal Eur. J. Biochem. 50 (3), 489-494 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878