Search Tips

  • THAT   AND
  • THAT   AND


Homo sapiens plasminogen (PLG), transcript variant 1, mRNA.


RefSeq Accession Definition Sequence Price Select
NM_000301 Homo sapiens plasminogen (PLG), transcript variant 1, mRNA. Full Lenth $1238.30
ORF Sequence $705.57


RefSeq Version NM_000301.3, 270132869
Length 3538 bp
Structure linear
Update Date 01-MAY-2011
Organism Homo sapiens (human)
Definition Homo sapiens plasminogen (PLG), transcript variant 1, mRNA.
Product plasminogen isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasmin dissolves fibrin in blood clots and is an important protease in many other cellular processes while angiostatin inhibits angiogenesis. Defects in this gene are likely a cause of thrombophilia and ligneous conjunctivitis. Two transcript variants encoding different isoforms have been found for this gene.


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.
RefSeq NP_000292.1
CDS 113..2545
Exon (1)1..161
Exon (2)1..161
Exon (3)162..297
Exon (4)298..404
Exon (5)405..519
Exon (6)520..659
Exon (7)660..780
Exon (8)781..899
Exon (9)900..1062
Exon (10)1063..1208
Exon (11)1209..1368
Exon (12)1369..1550
Exon (13)1551..1699
Exon (14)1700..1793
Exon (15)1794..1914
Exon (16)1915..1989
Exon (17)1990..2130
Exon (18)2131..2237
Exon (19)2238..2383
Exon (20)2384..3538
Translation MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
30+c, tdbSNP:1049569
64+c, tdbSNP:1652503
78+a, gdbSNP:4252060
81+a, cdbSNP:1049570
124+a, gdbSNP:4252061
complement(175)-g, adbSNP:4063623
224+a, gdbSNP:73015965
247+c, tdbSNP:1049571
249+g, tdbSNP:1049573
281+a, gdbSNP:4252070
281+a, gdbSNP:1804179
328+a, gdbSNP:1049634
351+a, gdbSNP:1804180
412+c, tdbSNP:61731705
442+c, tdbSNP:4757
complement(455)-t, cdbSNP:78899783
510+a, gdbSNP:61731706
510+a, gdbSNP:72627451
511+a, cdbSNP:4252186
803..805+, aagdbSNP:121918034
816+a, gdbSNP:121918030
883+c, tdbSNP:14224
894+a, gdbSNP:4252187
1054+c, tdbSNP:1130656
1073+a, gdbSNP:76192728
1195+a, gdbSNP:13231
1232+g, tdbSNP:121918028
1334+c, tdbSNP:4252119
1451..1452+, gdbSNP:36089164
1470+a, tdbSNP:1804181
1492+a, tdbSNP:116573785
1526+a, gdbSNP:4252125
1543+c, tdbSNP:4699
1547+g, tdbSNP:121918032
1593+c, tdbSNP:4252128
1679+c, tdbSNP:4252129
1768+c, tdbSNP:113153850
1883+c, tdbSNP:121918029
1960+a, gdbSNP:121918031
1964+c, tdbSNP:4252195
1970+a, gdbSNP:121918027
2053+a, gdbSNP:61731712
2074+g, tdbSNP:4252196
2139+a, tdbSNP:17857492
2194+c, tdbSNP:4252170
2363+a, gdbSNP:121918033
2371+c, tdbSNP:4252175
2398+g, tdbSNP:11060
2482+c, tdbSNP:13112
2590+a, gdbSNP:57037765
complement(2590)-t, cdbSNP:6690
2666+c, tdbSNP:41267833
2830+, tdbSNP:4252177
2833+, tdbSNP:79857892
2834+, tdbSNP:10712344
2956+c, tdbSNP:117330062
complement(3031)-g, adbSNP:783169
complement(3046)-t, cdbSNP:783168
3082+a, gdbSNP:4252178
3110+a, gdbSNP:80294183
complement(3110)-t, cdbSNP:783167
complement(3142)-c, adbSNP:1050912
3299+a, gdbSNP:111899543
3320+a, gdbSNP:4252179
complement(3323)-g, cdbSNP:11902
3326+a, gdbSNP:4252180
3328+a, gdbSNP:115406365
3385+c, tdbSNP:4252199
3421+c, tdbSNP:117160816
3456+c, tdbSNP:4252181
3531+c, tdbSNP:4252182
Gene SymbolPLG
Gene SynonymDKFZp779M0222
Chromosome6
Locus Map6q26
All Transcripts NM_000301 , NM_001168338
Title Plasminogen promotes influenza A virus replication through an annexin 2-dependent pathway in the absence of neuraminidase .
Author LeBouder,F., Lina,B., Rimmelzwaan,G.F. and Riteau,B.
Journal J. Gen. Virol. 91 (PT 11), 2753-2761 (2010)
Title Activation of plasminogen by staphylokinase reduces the severity of Staphylococcus aureus systemic infection .
Author Kwiecinski,J., Josefsson,E., Mitchell,J., Higgins,J., Magnusson,M., Foster,T., Jin,T. and Bokarewa,M.
Journal J. Infect. Dis. 202 (7), 1041-1049 (2010)
Title Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study .
Author Bailey,S.D., Xie,C., Do,R., Montpetit,A., Diaz,R., Mohan,V., Keavney,B., Yusuf,S., Gerstein,H.C., Engert,J.C. and Anand,S.
Journal Diabetes Care 33 (10), 2250-2253 (2010)
Title NMR backbone dynamics of VEK-30 bound to the human plasminogen kringle 2 domain .
Author Wang,M., Prorok,M. and Castellino,F.J.
Journal Biophys. J. 99 (1), 302-312 (2010)
Title Contribution of plasminogen activation towards the pathogenic potential of oral streptococci .
Author Itzek,A., Gillen,C.M., Fulde,M., Friedrichs,C., Rodloff,A.C., Chhatwal,G.S. and Nitsche-Schmitz,D.P.
Journal PLoS ONE 5 (11), E13826 (2010)
Title Chemical evidence that proteolytic cleavage causes the heterogeneity present in human ceruloplasmin preparations .
Author Kingston,I.B., Kingston,B.L. and Putnam,F.W.
Journal Proc. Natl. Acad. Sci. U.S.A. 74 (12), 5377-5381 (1977)
Title Primary structure of the B-chain of human plasmin .
Author Wiman,B.
Journal Eur. J. Biochem. 76 (1), 129-137 (1977)
Title Isolation and characterization of alpha2-plasmin inhibitor from human plasma. A novel proteinase inhibitor which inhibits activator-induced clot lysis .
Author Moroi,M. and Aoki,N.
Journal J. Biol. Chem. 251 (19), 5956-5965 (1976)
Title Amino-acid sequence of the cyanogen-bromide fragment from human plasminogen that forms the linkage between the plasmin chains .
Author Wiman,B. and Wallen,P.
Journal Eur. J. Biochem. 58 (2), 539-547 (1975)
Title Structural relationship between 'glutamic acid' and 'lysine' forms of human plasminogen and their interaction with the NH2-terminal activation peptide as studied by affinity chromatography .
Author Wiman,B. and Wallen,P.
Journal Eur. J. Biochem. 50 (3), 489-494 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878