• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens plasminogen (PLG), transcript variant 1, mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu22912 Homo sapiens plasminogen (PLG), transcript variant 1, mRNA. pcDNA3.1+-DYK On-demand $279.00 12-14
OHu22912C Homo sapiens plasminogen (PLG), transcript variant 1, mRNA. Customized vector On-demand $329.00 12-14

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000301.3, 270132869
Length 2433 bp
Structure linear
Update Date 10-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens plasminogen (PLG), transcript variant 1, mRNA.
Product plasminogen isoform 1 precursor
Comment

Summary: The protein encoded by this gene is a secreted blood zymogen that is activated by proteolysis and converted to plasmin and angiostatin. Plasmin dissolves fibrin in blood clots and is an important protease in many other cellular processes while angiostatin inhibits angiogenesis. Defects in this gene are likely a cause of thrombophilia and ligneous conjunctivitis. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Dec 2009].


Transcript Variant: This variant (1) represents the longer transcript and encodes the longer isoform (1).


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000292.1
CDS 113..2545
Misc Feature(1)53..55
Misc Feature(2)53..55
Misc Feature(3)167..169
Misc Feature(4)<224..403
Misc Feature(5)order(224..226,230..232,266..268)
Misc Feature(6)344..349
Misc Feature(7)344..346
Misc Feature(8)398..400
Misc Feature(9)398..400
Misc Feature(10)398..400
Misc Feature(11)416..658
Misc Feature(12)446..448
Misc Feature(13)order(491..493,521..523,599..601,605..607,629..631)
Misc Feature(14)656..898
Misc Feature(15)order(674..676,1058..1060)
Misc Feature(16)692..694
Misc Feature(17)order(737..739,767..769,842..844,848..850,872..874)
Misc Feature(18)914..916
Misc Feature(19)926..1171
Misc Feature(20)962..964
Misc Feature(21)order(1007..1009,1037..1039,1112..1114,1118..1120,
Misc Feature(22)1034..1036
Misc Feature(23)1205..1207
Misc Feature(24)1235..1477
Misc Feature(25)1268..1270
Misc Feature(26)order(1313..1315,1343..1345,1418..1420,1424..1426,
Misc Feature(27)1484..1486
Misc Feature(28)1505..1507
Misc Feature(29)1508..1513
Misc Feature(30)1508..1510
Misc Feature(31)1508..1510
Misc Feature(32)1544..1795
Misc Feature(33)order(1553..1555,1790..1792)
Misc Feature(34)1580..1582
Misc Feature(35)order(1616..1618,1739..1741)
Misc Feature(36)order(1625..1627,1658..1660,1736..1738,1742..1744,
Misc Feature(37)order(1703..1705,1775..1777)
Misc Feature(38)1757..1759
Misc Feature(39)1799..1801
Misc Feature(40)order(2165..2167,1811..1813)
Misc Feature(41)order(1865..1867,1841..1843)
Misc Feature(42)1850..2521
Misc Feature(43)1850..1855
Misc Feature(44)1850..1852
Misc Feature(45)1850..1852
Misc Feature(46)1853..2524
Misc Feature(47)1853..1855
Misc Feature(48)1901..1903
Misc Feature(49)1901..1903
Misc Feature(50)order(1976..1978,2105..2107,2390..2392)
Misc Feature(51)2012..2014
Misc Feature(52)2120..2122
Misc Feature(53)2150..2152
Misc Feature(54)2261..2263
Misc Feature(55)2291..2293
Misc Feature(56)order(2372..2374,2447..2449,2453..2455)
Exon (1)1..161
Gene:PLG
Gene Synonym:PLG
Exon (2)162..297
Gene:PLG
Gene Synonym:PLG
Exon (3)298..404
Gene:PLG
Gene Synonym:PLG
Exon (4)405..519
Gene:PLG
Gene Synonym:PLG
Exon (5)520..659
Gene:PLG
Gene Synonym:PLG
Exon (6)660..780
Gene:PLG
Gene Synonym:PLG
Exon (7)781..899
Gene:PLG
Gene Synonym:PLG
Exon (8)900..1062
Gene:PLG
Gene Synonym:PLG
Exon (9)1063..1208
Gene:PLG
Gene Synonym:PLG
Exon (10)1209..1368
Gene:PLG
Gene Synonym:PLG
Exon (11)1369..1550
Gene:PLG
Gene Synonym:PLG
Exon (12)1551..1699
Gene:PLG
Gene Synonym:PLG
Exon (13)1700..1793
Gene:PLG
Gene Synonym:PLG
Exon (14)1794..1914
Gene:PLG
Gene Synonym:PLG
Exon (15)1915..1989
Gene:PLG
Gene Synonym:PLG
Exon (16)1990..2130
Gene:PLG
Gene Synonym:PLG
Exon (17)2131..2237
Gene:PLG
Gene Synonym:PLG
Exon (18)2238..2383
Gene:PLG
Gene Synonym:PLG
Exon (19)2384..3538
Gene:PLG
Gene Synonym:PLG
Translation MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
64+a, gdbSNP:113759707
74+c, tdbSNP:187896045
78+a, gdbSNP:4252060
105+a, gdbSNP:374037660
124+a, gdbSNP:4252061
148+a, gdbSNP:371469289
complement(175)-dbSNP:
complement(175)-g, adbSNP:4063623
211+g, tdbSNP:140570408
224+a, gdbSNP:73015965
226+c, gdbSNP:372999008
227+a, cdbSNP:138353396
235+g, tdbSNP:372972552
238+a, gdbSNP:374911072
247+c, tdbSNP:1049571
249+g, tdbSNP:1049573
280+c, tdbSNP:144100362
281+a, gdbSNP:4252070
311+dbSNP:
311+c, tdbSNP:140789621
376+a, gdbSNP:189824042
378+a, gdbSNP:143079629
393+c, tdbSNP:373442935
412+dbSNP:
412+c, tdbSNP:61731705
418+c, gdbSNP:144747470
428+g, tdbSNP:141284301
442+c, tdbSNP:4757
453+c, tdbSNP:139357983
469+a, tdbSNP:377275189
480+c, tdbSNP:370856655
510+a, gdbSNP:61731706
511+a, cdbSNP:4252186
515+c, tdbSNP:199833895
529+dbSNP:
529+c, tdbSNP:374989402
571+a, gdbSNP:144153702
577+a, gdbSNP:368638671
580+a, cdbSNP:146415258
583+c, tdbSNP:372617319
584+a, gdbSNP:141045811
588+c, tdbSNP:201792453
605+c, tdbSNP:139828885
617+a, cdbSNP:143256245
625+c, gdbSNP:374619723
626+a, gdbSNP:145535174
634+c, tdbSNP:368221997
637+c, tdbSNP:371986721
641+a, gdbSNP:374903528
650+a, gdbSNP:369353385
672+dbSNP:
672+a, gdbSNP:377016135
693+a, tdbSNP:150072546
694+c, tdbSNP:145192723
710+a, gdbSNP:149145958
724+a, gdbSNP:369715307
734+g, tdbSNP:201014517
758+a, gdbSNP:374234922
767+c, tdbSNP:151092364
770+a, gdbSNP:377537611
803..805+dbSNP:
803..805+, aagdbSNP:121918034
816+a, gdbSNP:121918030
823+c, tdbSNP:200226472
832+a, gdbSNP:142604256
850+a, cdbSNP:146910079
855+c, tdbSNP:139012522
861+c, tdbSNP:372026592
870+a, gdbSNP:143034754
883+a, gdbSNP:386531300
883+c, tdbSNP:14224
884+a, gdbSNP:138242513
894+a, gdbSNP:4252187
963+dbSNP:
963+g, tdbSNP:371746732
967+a, gdbSNP:202061577
1054+c, tdbSNP:1130656
complement(1073)-dbSNP:
complement(1073)-g, adbSNP:76192728
1127+a, gdbSNP:200604924
1135+a, tdbSNP:138051887
1136+a, gdbSNP:199771790
1139+c, tdbSNP:142647215
1183+a, gdbSNP:146041064
1187+a, gdbSNP:201973253
1195+a, gdbSNP:13231
1202+c, tdbSNP:369616186
1232+dbSNP:
1232+g, tdbSNP:121918028
1236+a, gdbSNP:142086839
1253+g, tdbSNP:376572197
1260+a, gdbSNP:370326625
1279+c, tdbSNP:372689013
1334+c, tdbSNP:4252119
1371+dbSNP:
1371+a, gdbSNP:139071351
1393+a, gdbSNP:149909079
1420+c, gdbSNP:370807852
1447+g, tdbSNP:371661937
1451..1452+, gdbSNP:36089164
1470+a, tdbSNP:1804181
1492+a, tdbSNP:116573785
1497+c, tdbSNP:142565890
1502+a, cdbSNP:374635068
1506+c, tdbSNP:374995543
1507+a, gdbSNP:368155641
1526+a, gdbSNP:4252125
1543+c, tdbSNP:4699
1547+g, tdbSNP:121918032
1570+dbSNP:
1570+a, g, tdbSNP:141539231
1580+a, cdbSNP:367707054
1581+a, gdbSNP:140537724
1593+c, tdbSNP:4252128
1611+c, tdbSNP:140970354
1615+a, tdbSNP:150227219
1631+g, tdbSNP:138011858
1632+c, tdbSNP:372603134
1662+c, tdbSNP:377265821
1679+c, tdbSNP:4252129
1747+dbSNP:
1747+a, gdbSNP:370774291
1768+c, tdbSNP:113153850
1769+a, gdbSNP:182937977
1834+dbSNP:
1834+a, gdbSNP:146030266
1847+a, gdbSNP:138728014
1875+a, gdbSNP:202141531
1876+c, tdbSNP:201308812
1883+c, tdbSNP:121918029
1891+c, tdbSNP:368271141
1899+g, tdbSNP:372520102
1936+dbSNP:
1936+a, cdbSNP:372193015
1960+a, gdbSNP:121918031
1964+c, tdbSNP:4252195
1970+a, gdbSNP:121918027
1981+c, tdbSNP:144424879
2008+dbSNP:
2008+c, tdbSNP:375051997
2047+c, tdbSNP:182180648
2048+a, gdbSNP:369196761
2052+c, tdbSNP:187157735
2053+a, c, gdbSNP:61731712
2074+g, tdbSNP:4252196
2137+dbSNP:
2137+a, cdbSNP:370325463
2138+a, gdbSNP:142551860
2139+a, tdbSNP:17857492
2157+a, tdbSNP:147175166
2194+c, tdbSNP:4252170
2195+a, gdbSNP:181030365
2198+c, gdbSNP:144869703
2199+a, gdbSNP:147930532
2204+a, gdbSNP:201323384
2246+dbSNP:
2246+a, gdbSNP:202074006
2271+a, gdbSNP:200731501
2296+a, gdbSNP:140580870
2304+a, gdbSNP:150065136
2306+c, tdbSNP:145177652
2307+a, gdbSNP:149148300
2361+c, tdbSNP:138277465
2363+a, gdbSNP:121918033
2371+c, tdbSNP:4252175
2398+dbSNP:
2398+g, tdbSNP:11060
2414+a, gdbSNP:199619244
2468+c, tdbSNP:200857824
2469+a, gdbSNP:376140019
2551+c, tdbSNP:370809839
2552+a, gdbSNP:181878511
complement(2590)-t, cdbSNP:6690
2593+a, gdbSNP:150437480
2666+c, tdbSNP:41267833
2701+c, gdbSNP:375006147
2709+c, tdbSNP:372763926
2716+c, gdbSNP:140323614
2830+a, tdbSNP:201911710
2830+, tdbSNP:4252177
2832..2833+a, ttdbSNP:369537132
2835+, adbSNP:200319086
2877+a, cdbSNP:145476240
2899+c, gdbSNP:186439505
2918+a, gdbSNP:189281351
2956+c, tdbSNP:117330062
complement(3031)-g, adbSNP:783169
3040+c, tdbSNP:181010511
complement(3046)-t, cdbSNP:783168
3061+c, tdbSNP:185993564
3082+a, gdbSNP:4252178
3102+, gdbSNP:369140852
3105+c, gdbSNP:373956668
complement(3110)-t, cdbSNP:783167
3142+a, c, tdbSNP:1050912
3176+a, gdbSNP:147387427
3200+a, cdbSNP:139573422
3259+a, gdbSNP:376724881
3299+a, gdbSNP:111899543
3320+a, gdbSNP:4252179
complement(3323)-g, cdbSNP:11902
3326+a, gdbSNP:4252180
3328+a, gdbSNP:115406365
3385+c, tdbSNP:4252199
3403+a, cdbSNP:139942589
3421+c, tdbSNP:183109765
3456+c, tdbSNP:4252181
3531+c, tdbSNP:4252182
Gene SymbolPLG
Gene SynonymPLG
Chromosome6
Locus Map6q26
Title Characterization of a reduced form of plasma plasminogen as the precursor for angiostatin formation .
Author Butera D, Wind T, Lay AJ, Beck J, Castellino FJ and Hogg PJ.
Journal J. Biol. Chem. 289 (5), 2992-3000 (2014)
Title Comprehensive genetic analysis of complement and coagulation genes in atypical hemolytic uremic syndrome .
Author Bu F, Maga T, Meyer NC, Wang K, Thomas CP, Nester CM and Smith RJ.
Journal J. Am. Soc. Nephrol. 25 (1), 55-64 (2014)
Title Serum levels of angiogenic and anti-angiogenic factors: their prognostic relevance in locally advanced hepatocellular carcinoma .
Author Sharma BK, Srinivasan R, Kapil S, Singla B, Saini N, Chawla YK, Chakraborti A, Duseja A, Kalra N and Dhiman RK.
Journal Mol. Cell. Biochem. 383 (1-2), 103-112 (2013)
Title [System of activation of plasminogen in Vibrio cholerae] .
Author Mishan'kin,B.N., Duvanova,O.V., Shipko,E.S., Romanova,L.V., Vodop'ianov,A.S., Eribekian,A.K., Shishiianu,M.V., Lysova,L.K. and Vodop'ianov,S.O.
Journal Zh. Mikrobiol. Epidemiol. Immunobiol. 5, 13-20 (2013)
Title A key role for the urokinase plasminogen activator (uPA) in invasive Group A streptococcal infection .
Author Sanderson-Smith ML, Zhang Y, Ly D, Donahue D, Hollands A, Nizet V, Ranson M, Ploplis VA, Walker MJ and Castellino FJ.
Journal PLoS Pathog. 9 (7), E1003469 (2013)
Title Chemical evidence that proteolytic cleavage causes the heterogeneity present in human ceruloplasmin preparations .
Author Kingston,I.B., Kingston,B.L. and Putnam,F.W.
Journal Proc. Natl. Acad. Sci. U.S.A. 74 (12), 5377-5381 (1977)
Title Primary structure of the B-chain of human plasmin .
Author Wiman,B.
Journal Eur. J. Biochem. 76 (1), 129-137 (1977)
Title Isolation and characterization of alpha2-plasmin inhibitor from human plasma. A novel proteinase inhibitor which inhibits activator-induced clot lysis .
Author Moroi,M. and Aoki,N.
Journal J. Biol. Chem. 251 (19), 5956-5965 (1976)
Title Amino-acid sequence of the cyanogen-bromide fragment from human plasminogen that forms the linkage between the plasmin chains .
Author Wiman,B. and Wallen,P.
Journal Eur. J. Biochem. 58 (2), 539-547 (1975)
Title Structural relationship between 'glutamic acid' and 'lysine' forms of human plasminogen and their interaction with the NH2-terminal activation peptide as studied by affinity chromatography .
Author Wiman,B. and Wallen,P.
Journal Eur. J. Biochem. 50 (3), 489-494 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.