• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa) (PROC), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu36438 Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa) (PROC), mRNA. pcDNA3.1+-DYK On-demand $219.00 7-9
OHu36438C Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa) (PROC), mRNA. Customized vector On-demand $269.00 7-9

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Data sheet
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
Restriction Sites Hind III- EcoR I
RefSeq Version NM_000312.3, 270483720
Length 1386 bp
Structure linear
Update Date 04-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa) (PROC), mRNA.
Product vitamin K-dependent protein C preproprotein
Comment

Summary: This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated forms of coagulation factors V and VIII. Mutations in this gene have been associated with thrombophilia due to protein C deficiency, neonatal purpura fulminans, and recurrent venous thrombosis.[provided by RefSeq, Dec 2009].

RefSeq NP_000303.1
CDS 95..1480
Misc Feature(1)164..355
Misc Feature(2)218..220
Misc Feature(3)236..238
Misc Feature(4)236..238
Misc Feature(5)239..241
Misc Feature(6)239..241
Misc Feature(7)260..262
Misc Feature(8)260..262
Misc Feature(9)266..268
Misc Feature(10)266..268
Misc Feature(11)275..277
Misc Feature(12)275..277
Misc Feature(13)278..280
Misc Feature(14)278..280
Misc Feature(15)293..295
Misc Feature(16)293..295
Misc Feature(17)296..298
Misc Feature(18)296..298
Misc Feature(19)305..307
Misc Feature(20)305..307
Misc Feature(21)395..490
Misc Feature(22)431..433
Misc Feature(23)431..433
Misc Feature(24)509..511
Misc Feature(25)512..619
Misc Feature(26)683..685
Misc Feature(27)689..691
Misc Feature(28)725..1429
Misc Feature(29)725..730
Misc Feature(30)731..1438
Misc Feature(31)order(851..853,989..991,1298..1300)
Misc Feature(32)962..964
Misc Feature(33)1157..1159
Misc Feature(34)1205..1207
Misc Feature(35)order(1280..1282,1355..1357,1361..1363)
Exon (1)1..73
Gene:PROC
Gene Synonym:APC; PC; PROC1; THPH3; THPH4
Exon (2)74..164
Gene:PROC
Gene Synonym:APC; PC; PROC1; THPH3; THPH4
Exon (3)165..331
Gene:PROC
Gene Synonym:APC; PC; PROC1; THPH3; THPH4
Exon (4)332..356
Gene:PROC
Gene Synonym:APC; PC; PROC1; THPH3; THPH4
Exon (5)357..494
Gene:PROC
Gene Synonym:APC; PC; PROC1; THPH3; THPH4
Exon (6)495..629
Gene:PROC
Gene Synonym:APC; PC; PROC1; THPH3; THPH4
Exon (7)630..772
Gene:PROC
Gene Synonym:APC; PC; PROC1; THPH3; THPH4
Exon (8)773..890
Gene:PROC
Gene Synonym:APC; PC; PROC1; THPH3; THPH4
Exon (9)891..1780
Gene:PROC
Gene Synonym:APC; PC; PROC1; THPH3; THPH4
Translation MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
41+dbSNP:
41+a, gdbSNP:2069936
43+c, tdbSNP:148484185
45+a, tdbSNP:1799810
62+c, tdbSNP:116169054
124+c, tdbSNP:148490199
125+a, gdbSNP:368493458
146+a, gdbSNP:146793243
160+c, tdbSNP:144300387
212+dbSNP:
212+c, tdbSNP:199514227
219+a, gdbSNP:369504169
232+c, gdbSNP:141040323
254+a, tdbSNP:376049280
279+a, cdbSNP:121918148
292+c, gdbSNP:201463891
302+a, gdbSNP:199469481
320+a, gdbSNP:121918149
353+dbSNP:
353+a, gdbSNP:145854591
410+dbSNP:
410+g, tdbSNP:199469479
416+a, cdbSNP:200234655
423+c, gdbSNP:370147557
434+c, gdbSNP:374476971
437+a, gdbSNP:201563330
443..446+, agctdbSNP:199469477
493+c, tdbSNP:200045749
517+dbSNP:
517+g, tdbSNP:5936
527+a, gdbSNP:370813536
540+a, cdbSNP:121918159
556+a, gdbSNP:201952795
562+c, gdbSNP:201105510
618+a, gdbSNP:199469474
628+a, gdbSNP:368367611
632+dbSNP:
632+a, cdbSNP:370212196
635+g, tdbSNP:199469470
659+c, tdbSNP:146922325
668..670+, aagdbSNP:199469469
674+c, tdbSNP:371071104
723+c, tdbSNP:121918145
724+a, gdbSNP:2069927
725+c, tdbSNP:121918143
726+a, gdbSNP:199469476
752+c, tdbSNP:121918152
753+a, gdbSNP:121918153
763+a, cdbSNP:199469483
772+c, gdbSNP:121918155
797+dbSNP:
797+a, cdbSNP:370086431
808+c, tdbSNP:141249033
810..811+, gdbSNP:199469475
812..813+, gdbSNP:200187516
840+c, tdbSNP:375156587
862+c, tdbSNP:5937
887+c, tdbSNP:121918156
904+dbSNP:
904+c, gdbSNP:371007615
908+c, tdbSNP:121918154
928+a, gdbSNP:146289521
936+a, tdbSNP:375179157
960+c, tdbSNP:121918151
969+a, gdbSNP:202150408
972+a, gdbSNP:144233408
975+a, gdbSNP:200721675
983+c, gdbSNP:199469471
985+c, tdbSNP:5935
994+c, tdbSNP:112356403
996+c, tdbSNP:121918144
1008+, tdbSNP:34222720
1018+c, tdbSNP:13388546
1019+a, gdbSNP:121918146
1021+c, tdbSNP:200731614
1029+c, tdbSNP:121918160
1030+a, gdbSNP:199679356
1074+a, tdbSNP:199469480
1076+c, tdbSNP:201907715
1094+a, gdbSNP:121918150
1104+c, tdbSNP:369881972
1109+a, gdbSNP:121918158
1117+c, tdbSNP:373299422
1121+a, gdbSNP:121918147
1136+c, tdbSNP:121918141
1137+a, gdbSNP:201827066
1169+a, gdbSNP:375912553
1193+a, gdbSNP:140582220
1201+a, gdbSNP:61731660
1205+a, gdbSNP:145800354
1216+c, tdbSNP:187228759
1217+a, gdbSNP:368901479
1255+c, tdbSNP:148855579
1258+a, gdbSNP:373028935
1273+c, tdbSNP:148035465
1288+c, tdbSNP:146028808
1290+a, cdbSNP:201399407
1295+a, gdbSNP:142742242
1306+a, gdbSNP:370637632
1316+a, gdbSNP:374259918
1328+a, gdbSNP:139741458
1343+c, gdbSNP:144760718
1352+g, tdbSNP:199469472
1393+c, tdbSNP:151319700
1396+c, tdbSNP:377613736
1426+c, gdbSNP:121918142
1427+a, cdbSNP:200012319
1429+c, gdbSNP:121918157
1436+c, tdbSNP:368520760
1438+c, tdbSNP:367727016
1450+a, gdbSNP:371265125
1453+a, gdbSNP:374484815
1473+a, cdbSNP:367745240
1478+c, tdbSNP:370298954
1481+c, tdbSNP:199900627
1540+, gdbSNP:369564006
1553+c, tdbSNP:199469473
1597+c, gdbSNP:1042759
1626+c, tdbSNP:140461934
1634+a, tdbSNP:76963348
1656+c, tdbSNP:150393087
Gene SymbolPROC
Gene SynonymAPC; PC; PROC1; THPH3; THPH4
Chromosome2
Locus Map2q13-q14
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000312 Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa) (PROC), mRNA. On-demand $219.00 7-9
XM_005263715 PREDICTED: Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa) (PROC), transcript variant X1, mRNA. On-demand $219.00 7-9
XM_005263716 PREDICTED: Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa) (PROC), transcript variant X2, mRNA. On-demand TBD TBD
XM_005263717 PREDICTED: Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa) (PROC), transcript variant X3, mRNA. On-demand $219.00 7-9
XM_006712633 PREDICTED: Homo sapiens protein C (inactivator of coagulation factors Va and VIIIa) (PROC), transcript variant X4, mRNA. On-demand $219.00 7-9
Title Modulation of protein C activation by histones, platelet factor 4, and heparinoids: new insights into activated protein C formation .
Author Kowalska MA, Zhao G, Zhai L, David G 3rd, Marcus S, Krishnaswamy S and Poncz M.
Journal Arterioscler. Thromb. Vasc. Biol. 34 (1), 120-126 (2014)
Title Decreased activated protein C levels are inversely associated with the urinary albumin excretion rate in patients with type 2 diabetes .
Author Li,W., Lin,L., He,J., Lin,T., Zhu,X., Chen,F., Guo,M. and Chen,Y.
Journal Clin. Lab. 60 (2), 261-266 (2014)
Title A novel homozygous missense mutation (Val 325-->Ala) in the protein .
Author Witt I, Beck S, Seydewitz HH, Tasangil C and Schenck W.
Journal Blood Coagul. Fibrinolysis 5 (4), 651-653 (1994)
Title A novel homozygous missense mutation in the protein C (PROC) gene causing recurrent venous thrombosis .
Author Grundy CB, Chisholm M, Kakkar VV and Cooper DN.
Journal Hum. Genet. 89 (6), 683-684 (1992)
Title Sublocalization of the human protein C gene on chromosome 2q13-q14 .
Author Patracchini P, Aiello V, Palazzi P, Calzolari E and Bernardi F.
Journal Hum. Genet. 81 (2), 191-192 (1989)
Title Hereditary thrombophilia: identification of nonsense and missense mutations in the protein C gene .
Author Romeo,G., Hassan,H.J., Staempfli,S., Roncuzzi,L., Cianetti,L., Leonardi,A., Vicente,V., Mannucci,P.M., Bertina,R., Peschle,C. et al.
Journal Proc. Natl. Acad. Sci. U.S.A. 84 (9), 2829-2832 (1987)
Title The structure and evolution of a 461 amino acid human protein C precursor and its messenger RNA, based upon the DNA sequence of cloned human liver cDNAs .
Author Beckmann,R.J., Schmidt,R.J., Santerre,R.F., Plutzky,J., Crabtree,G.R. and Long,G.L.
Journal Nucleic Acids Res. 13 (14), 5233-5247 (1985)
Title The nucleotide sequence of the gene for human protein C .
Author Foster,D.C., Yoshitake,S. and Davie,E.W.
Journal Proc. Natl. Acad. Sci. U.S.A. 82 (14), 4673-4677 (1985)
Title Human plasma protein C: isolation, characterization, and mechanism of activation by alpha-thrombin .
Author Kisiel,W.
Journal J. Clin. Invest. 64 (3), 761-769 (1979)
Title A new vitamin K-dependent protein. A phospholipid-binding zymogen of a serine esterase .
Author Esmon,C.T., Stenflo,J. and Suttie,J.W.
Journal J. Biol. Chem. 251 (10), 3052-3056 (1976)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.