• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein S (alpha) (PROS1), mRNA.


RefSeq Accession Definition Services Price Order
NM_000313 Homo sapiens protein S (alpha) (PROS1), mRNA. ORF Sequence $588.99
Peptide Services
Antibody Services
Protein Services


RefSeq Version NM_000313.3, 223671900
Length 3595 bp
Structure linear
Update Date 17-APR-2013
Organism Homo sapiens (human)
Definition Homo sapiens protein S (alpha) (PROS1), mRNA.
Product vitamin K-dependent protein S preproprotein
Comment

Summary: This gene encodes a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in this gene result in autosomal dominant hereditary thrombophilia. An inactive pseudogene of this locus is located at an adjacent region on chromosome 3. [provided by RefSeq, Feb 2009].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000304.2
CDS 342..2372
Misc Feature(1)90..92
Misc Feature(2)90..92
Misc Feature(3)408..596
Misc Feature(4)480..482
Misc Feature(5)483..485
Misc Feature(6)504..506
Misc Feature(7)510..512
Misc Feature(8)519..521
Misc Feature(9)522..524
Misc Feature(10)537..539
Misc Feature(11)540..542
Misc Feature(12)549..551
Misc Feature(13)558..560
Misc Feature(14)570..572
Misc Feature(15)603..689
Misc Feature(16)696..806
Misc Feature(17)order(699..701,747..749)
Misc Feature(18)810..911
Misc Feature(19)order(810..812,819..821,870..872)
Misc Feature(20)942..1040
Misc Feature(21)order(942..944,951..953,996..998)
Misc Feature(22)1011..1079
Misc Feature(23)1068..1190
Misc Feature(24)1275..1706
Misc Feature(25)1836..1838
Misc Feature(26)1866..2282
Exon (1)1..417
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (2)418..575
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (3)576..600
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (4)601..687
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (5)688..810
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (6)811..942
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (7)943..1068
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (8)1069..1190
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (9)1191..1306
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (10)1307..1496
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (11)1497..1664
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (12)1665..1833
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (13)1834..1985
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (14)1986..2211
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (15)2212..3580
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Translation MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIE ELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQ CSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPG SYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKS CEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIE VQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVE KGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLV DSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHND IRAHSCPSVWKKTKNS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(152)-g, cdbSNP:149028936
complement(174)-t, cdbSNP:199469484
complement(217)-t, gdbSNP:115932544
complement(338)-t, cdbSNP:4390971
complement(373)-t, cdbSNP:1130095
complement(422)-dbSNP:
complement(422)-g, cdbSNP:200631087
complement(435)-t, cdbSNP:192961830
complement(460)-c, adbSNP:7614835
complement(493..494)-, agdbSNP:199469485
complement(568)-g, adbSNP:73846070
complement(569)-t, gdbSNP:6121
complement(574)-t, cdbSNP:6122
complement(575)-t, cdbSNP:145399944
complement(579)-dbSNP:
complement(579)-g, adbSNP:145704559
complement(599)-t, cdbSNP:139964194
complement(604..613)-dbSNP:
complement(604..613)-gtcttcgctc, tadbSNP:199469486
complement(610)-t, cdbSNP:200886866
complement(621)-t, cdbSNP:200093789
complement(625)-t, cdbSNP:144526169
complement(634)-g, cdbSNP:142805170
complement(671)-t, cdbSNP:201089893
complement(761)-dbSNP:
complement(761)-c, adbSNP:200181798
complement(772)-t, gdbSNP:146366248
complement(821)-dbSNP:
complement(821)-t, cdbSNP:75078530
complement(827)-t, cdbSNP:148015989
complement(844)-t, cdbSNP:144430063
complement(863..864)-, adbSNP:72410317
complement(870)-t, cdbSNP:138674918
complement(904)-t, cdbSNP:146070827
complement(917..924)-tgaaagc, gctttcaadbSNP:199469487
complement(927)-g, adbSNP:121918474
complement(931)-t, cdbSNP:150360829
complement(942)-g, adbSNP:199469497
complement(970)-dbSNP:
complement(970)-g, cdbSNP:140490120
complement(1003)-t, cdbSNP:1130097
complement(1028)-g, adbSNP:149129715
complement(1039)-t, cdbSNP:41267007
complement(1040..1041)-, adbSNP:34250262
complement(1079)-dbSNP:
complement(1079)-t, gdbSNP:139786558
complement(1114)-g, adbSNP:121918473
complement(1128)-t, cdbSNP:1130098
complement(1155)-t, cdbSNP:41267005
complement(1165)-g, adbSNP:200839461
complement(1176)-t, cdbSNP:121918475
complement(1206)-dbSNP:
complement(1206)-t, cdbSNP:199469488
complement(1227)-c, adbSNP:5003037
complement(1248)-g, adbSNP:5003036
complement(1250)-g, adbSNP:5003035
complement(1260)-t, gdbSNP:5003034
complement(1288)-g, adbSNP:5003033
complement(1346)-t, cdbSNP:201547678
complement(1349)-g, adbSNP:141208672
complement(1350)-c, adbSNP:200771229
complement(1362)-t, cdbSNP:189883848
complement(1373)-g, adbSNP:78449232
complement(1374)-t, gdbSNP:1130107
complement(1397)-c, adbSNP:199797185
complement(1436)-t, gdbSNP:199469491
complement(1448)-g, adbSNP:138227513
1487..1488+, atdbSNP:312262905
complement(1496)-t, gdbSNP:199469492
complement(1556)-dbSNP:
complement(1556)-c, adbSNP:201275494
complement(1570)-c, adbSNP:199469495
complement(1589)-t, cdbSNP:148869673
complement(1674)-t, cdbSNP:5017719
complement(1682)-t, cdbSNP:5017718
complement(1692)-t, cdbSNP:5017717
complement(1695)-g, adbSNP:5017716
complement(1702)-t, cdbSNP:142464892
complement(1734)-t, gdbSNP:199469496
complement(1763)-t, cdbSNP:5017715
complement(1775)-g, adbSNP:199750003
complement(1778..1779)-, ggdbSNP:199469499
complement(1804)-t, cdbSNP:5017714
complement(1822)-g, adbSNP:5017713
complement(1824)-g, adbSNP:5017712
complement(1827..1831)-, gattadbSNP:199469498
complement(1835)-dbSNP:
complement(1835)-g, adbSNP:76877671
complement(1842)-t, g, cdbSNP:121918472
complement(1854)-t, cdbSNP:185502739
complement(1869)-t, cdbSNP:138925964
complement(1884)-t, cdbSNP:199469500
complement(1920)-g, cdbSNP:143448451
complement(1937)-t, cdbSNP:55897523
complement(2018)-dbSNP:
complement(2018)-t, cdbSNP:184798444
complement(2021)-t, adbSNP:199469503
complement(2022)-t, g, cdbSNP:121918476
complement(2058)-g, adbSNP:202089574
complement(2088)-t, gdbSNP:139479630
complement(2101)-g, adbSNP:200228050
complement(2102)-g, cdbSNP:148234743
complement(2103)-t, cdbSNP:142846443
complement(2136)-g, cdbSNP:193013939
complement(2188)-g, adbSNP:145711536
complement(2230)-dbSNP:
complement(2230)-g, adbSNP:202190731
complement(2269)-t, adbSNP:140472966
complement(2322)-t, cdbSNP:141122478
complement(2331)-g, adbSNP:147324335
complement(2342)-g, adbSNP:6123
2372+a, tdbSNP:267606981
complement(2404)-t, gdbSNP:199820528
complement(2569)-g, adbSNP:182088150
complement(2742)-t, cdbSNP:144135580
complement(2752)-t, adbSNP:138546241
complement(2841)-t, gdbSNP:147496684
complement(2892)-t, gdbSNP:9681204
complement(3065)-t, cdbSNP:189450409
complement(3126)-t, gdbSNP:60153116
complement(3151)-c, adbSNP:112945093
complement(3155)-g, adbSNP:137965257
complement(3477)-g, adbSNP:186560028
complement(3542)-t, cdbSNP:140073790
Gene SymbolPROS1
Gene SynonymPROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Chromosome3
Locus Map3q11.2
All Transcripts
RefSeq Accession Definition Sequence Price Select
NM_000313 Homo sapiens protein S (alpha) (PROS1), mRNA. Full Length $1258.25
ORF Sequence $588.99
Title Identification of functionally important residues in TFPI Kunitz domain 3 required for the enhancement of its activity by protein S .
Author Ahnstrom,J., Andersson,H.M., Hockey,V., Meng,Y., McKinnon,T.A., Hamuro,T., Crawley,J.T. and Lane,D.A.
Journal Blood 120 (25), 5059-5062 (2012)
Title The vitamin K-dependent anticoagulant factor, protein S, inhibits multiple VEGF-A-induced angiogenesis events in a Mer- and SHP2-dependent manner .
Author Fraineau,S., Monvoisin,A., Clarhaut,J., Talbot,J., Simonneau,C., Kanthou,C., Kanse,S.M., Philippe,M. and Benzakour,O.
Journal Blood 120 (25), 5073-5083 (2012)
Title Proteomic profiling of androgen-independent prostate cancer cell lines reveals a role for protein S during the development of high grade and castration-resistant prostate cancer .
Author Saraon,P., Musrap,N., Cretu,D., Karagiannis,G.S., Batruch,I., Smith,C., Drabovich,A.P., Trudel,D., van der Kwast,T., Morrissey,C., Jarvi,K.A. and Diamandis,E.P.
Journal J. Biol. Chem. 287 (41), 34019-34031 (2012)
Title Small and large PROS1 deletions but no other types of rearrangements detected in patients with protein S deficiency .
Author Lind-Hallden,C., Dahlen,A., Hillarp,A., Zoller,B., Dahlback,B. and Hallden,C.
Journal Thromb. Haemost. 108 (1), 94-100 (2012)
Title Reevaluation of total, free, and bound protein S and C4b-binding protein levels in plasma anticoagulated with citrate or hirudin .
Author Griffin,J.H., Gruber,A. and Fernandez,J.A.
Journal Blood 79 (12), 3203-3211 (1992)
Title Protein-S, a vitamin K-dependent protein, is a bone matrix component synthesized and secreted by osteoblasts .
Author Maillard,C., Berruyer,M., Serre,C.M., Dechavanne,M. and Delmas,P.D.
Journal Endocrinology 130 (3), 1599-1604 (1992)
Title A novel functional assay of protein C in human plasma and its comparison with amidolytic and anticoagulant assays .
Author Guglielmone,H.A. and Vides,M.A.
Journal Thromb. Haemost. 67 (1), 46-49 (1992)
Title Intron-exon organization of the active human protein S gene PS alpha and its pseudogene PS beta: duplication and silencing during primate evolution .
Author Ploos van Amstel,H.K., Reitsma,P.H., van der Logt,C.P. and Bertina,R.M.
Journal Biochemistry 29 (34), 7853-7861 (1990)
Title Organization of the human protein S genes .
Author Schmidel,D.K., Tatro,A.V., Phelps,L.G., Tomczak,J.A. and Long,G.L.
Journal Biochemistry 29 (34), 7845-7852 (1990)
Title Radiation-induced damage in T4 bacteriophage: the effect of superoxide radicals and molecular oxygen .
Author Samuni,A., Chevion,M., Halpern,Y.S., Ilan,Y.A. and Czapski,G.
Journal Radiat. Res. 75 (3), 489-496 (1978)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878