• THAT   AND
  • THAT   AND


Sequence in raw or FASTA format:

Database:

Blast Method:

 
 


Homo sapiens protein S (alpha) (PROS1), mRNA.


Clone ID Definition Vector Stock Status Price *Turnaround time Order
OHu21617 Homo sapiens protein S (alpha) (PROS1), mRNA. pcDNA3.1+-DYK In-stock $99.00 5-7
OHu21617C Homo sapiens protein S (alpha) (PROS1), mRNA. Customized vector In-stock $149.00 5-7

*Business Day

Mutation services

Sequence Information ORF Nucleotide Sequence
Protein sequence
Vector pcDNA3.1+-DYK or customized vector
Clone information Clone Map
Tag on pcDNA3.1+-DYK N terminal DYKDDDK tags
ORF Insert Method CloneEZ® Seamless cloning technology
RefSeq Version NM_000313.3, 223671900
Length 2031 bp
Structure linear
Update Date 05-MAY-2014
Organism Homo sapiens (human)
Definition Homo sapiens protein S (alpha) (PROS1), mRNA.
Product vitamin K-dependent protein S preproprotein
Comment

Summary: This gene encodes a vitamin K-dependent plasma protein that functions as a cofactor for the anticoagulant protease, activated protein C (APC) to inhibit blood coagulation. It is found in plasma in both a free, functionally active form and also in an inactive form complexed with C4b-binding protein. Mutations in this gene result in autosomal dominant hereditary thrombophilia. An inactive pseudogene of this locus is located at an adjacent region on chromosome 3. [provided by RefSeq, Feb 2009].


Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments.

RefSeq NP_000304.2
CDS 342..2372
Misc Feature(1)90..92
Misc Feature(2)90..92
Misc Feature(3)408..596
Misc Feature(4)480..482
Misc Feature(5)483..485
Misc Feature(6)504..506
Misc Feature(7)510..512
Misc Feature(8)519..521
Misc Feature(9)522..524
Misc Feature(10)537..539
Misc Feature(11)540..542
Misc Feature(12)549..551
Misc Feature(13)558..560
Misc Feature(14)570..572
Misc Feature(15)603..689
Misc Feature(16)696..806
Misc Feature(17)order(699..701,747..749)
Misc Feature(18)810..911
Misc Feature(19)order(810..812,819..821,870..872)
Misc Feature(20)942..1067
Misc Feature(21)order(942..944,951..953,996..998)
Misc Feature(22)1080..1187
Misc Feature(23)1275..1706
Misc Feature(24)1836..1838
Misc Feature(25)1881..2282
Exon (1)1..417
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (2)418..575
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (3)576..600
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (4)601..687
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (5)688..810
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (6)811..942
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (7)943..1068
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (8)1069..1190
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (9)1191..1306
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (10)1307..1496
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (11)1497..1664
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (12)1665..1833
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (13)1834..1985
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (14)1986..2211
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Exon (15)2212..3580
Gene:PROS1
Gene Synonym:PROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Translation MRVLGGRCGALLACLLLVLPVSEANFLSKQQASQVLVRKRRANSLLEETKQGNLERECIE ELCNKEEAREVFENDPETDYFYPKYLVCLRSFQTGLFTAARQSTNAYPDLRSCVNAIPDQ CSPLPCNEDGYMSCKDGKASFTCTCKPGWQGEKCEFDINECKDPSNINGGCSQICDNTPG SYHCSCKNGFVMLSNKKDCKDVDECSLKPSICGTAVCKNIPGDFECECPEGYRYNLKSKS CEDIDECSENMCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL YLAEQFAGVVLYLKFRLPEISRFSAEFDFRTYDSEGVILYAESIDHSAWLLIALRGGKIE VQLKNEHTSKITTGGDVINNGLWNMVSVEELEHSISIKIAKEAVMDINKPGPLFKPENGL LETKVYFAGFPRKVESELIKPINPRLDGCIRSWNLMKQGASGIKEIIQEKQNKHCLVTVE KGSYYPGSGIAQFHIDYNNVSSAEGWHVNVTLNIRPSTGTGVMLALVSGNNTVPFAVSLV DSTSEKSQDILLSVENTVIYRIQALSLCSDQQSHLEFRVNRNNLELSTPLKIETISHEDL QRQLAVLDKAMKAKVATYLGGLPDVPFSATPVNAFYNGCMEVNINGVQLDLDEAISKHND IRAHSCPSVWKKTKNS
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
complement(152)-g, cdbSNP:149028936
174+c, tdbSNP:199469484
complement(217)-t, gdbSNP:115932544
complement(282)-g, cdbSNP:368555701
complement(299)-t, cdbSNP:370938580
338+c, tdbSNP:4390971
373+c, tdbSNP:1130095
complement(374)-g, cdbSNP:372436056
complement(422)-dbSNP:
complement(422)-g, cdbSNP:200631087
complement(435)-t, cdbSNP:192961830
complement(460)-c, adbSNP:7614835
493..494+, agdbSNP:199469485
complement(494)-t, cdbSNP:370320595
complement(507)-t, cdbSNP:377491237
complement(568)-g, adbSNP:73846070
569+g, tdbSNP:6121
574+c, tdbSNP:6122
complement(575)-t, cdbSNP:145399944
complement(579)-dbSNP:
complement(579)-g, adbSNP:145704559
complement(590)-t, cdbSNP:368834111
complement(599)-t, cdbSNP:139964194
604..613+dbSNP:
604..613+gtcttcgctc, tadbSNP:199469486
complement(610)-t, cdbSNP:200886866
complement(621)-t, cdbSNP:200093789
complement(625)-t, cdbSNP:144526169
complement(634)-g, cdbSNP:142805170
complement(640)-t, gdbSNP:375363379
complement(655)-t, cdbSNP:372589167
complement(671)-t, cdbSNP:201089893
complement(761)-dbSNP:
complement(761)-c, adbSNP:200181798
complement(772)-t, gdbSNP:146366248
complement(793)-c, adbSNP:372605525
complement(821)-dbSNP:
complement(821)-t, cdbSNP:75078530
complement(827)-t, cdbSNP:148015989
complement(844)-t, cdbSNP:144430063
complement(870)-t, cdbSNP:138674918
complement(904)-t, cdbSNP:146070827
917..924+gctttcaa, tgaaagcdbSNP:199469487
complement(926)-g, adbSNP:372109285
927+a, gdbSNP:121918474
complement(931)-t, cdbSNP:150360829
942+a, gdbSNP:199469497
complement(970)-dbSNP:
complement(970)-g, cdbSNP:140490120
1003+c, tdbSNP:1130097
complement(1008)-c, adbSNP:372919392
complement(1017)-t, adbSNP:370855515
complement(1025)-g, adbSNP:377173471
complement(1028)-g, adbSNP:149129715
complement(1032)-t, cdbSNP:372735635
complement(1039..1040)-, adbSNP:34250262
complement(1039)-t, cdbSNP:41267007
1042+a, gdbSNP:387906675
complement(1079)-dbSNP:
complement(1079)-t, gdbSNP:139786558
1114+a, gdbSNP:121918473
1128+c, tdbSNP:1130098
complement(1155)-t, cdbSNP:41267005
complement(1165)-g, adbSNP:200839461
1176+c, tdbSNP:121918475
complement(1193)-dbSNP:
complement(1193)-c, adbSNP:371425622
1206+c, tdbSNP:199469488
complement(1221)-t, cdbSNP:368607471
complement(1241)-g, adbSNP:376814926
complement(1287)-g, adbSNP:373983977
complement(1346)-t, cdbSNP:201547678
complement(1349)-g, adbSNP:141208672
complement(1350)-c, adbSNP:200771229
complement(1361)-g, adbSNP:374634410
complement(1362)-t, cdbSNP:189883848
complement(1373)-g, adbSNP:78449232
1374+g, tdbSNP:1130107
complement(1382)-t, cdbSNP:376656035
complement(1385)-t, cdbSNP:375245889
complement(1397)-c, adbSNP:199797185
1404+c, tdbSNP:387906674
complement(1448)-g, adbSNP:138227513
1487..1488+, atdbSNP:312262905
1496+g, tdbSNP:199469492
complement(1520)-dbSNP:
complement(1520)-g, adbSNP:373182289
complement(1524)-t, cdbSNP:368987511
complement(1556)-c, adbSNP:201275494
1570+a, cdbSNP:199469495
complement(1572)-g, cdbSNP:377398252
complement(1589)-t, cdbSNP:148869673
complement(1629)-g, adbSNP:374311589
complement(1635)-g, adbSNP:370129669
complement(1663)-g, adbSNP:375465427
complement(1672)-g, adbSNP:369244777
1674+c, tdbSNP:5017719
complement(1675)-t, cdbSNP:375034896
1692+c, tdbSNP:5017717
complement(1702)-t, cdbSNP:142464892
complement(1718)-t, cdbSNP:371312357
1734+g, tdbSNP:199469496
complement(1746)-t, cdbSNP:267599946
complement(1760)-t, cdbSNP:367557409
complement(1775)-g, adbSNP:199750003
1778..1779+, ggdbSNP:199469499
complement(1817)-t, cdbSNP:372203184
1827..1831+, gattadbSNP:199469498
complement(1835)-dbSNP:
complement(1835)-g, adbSNP:76877671
complement(1854)-t, cdbSNP:185502739
complement(1869)-t, cdbSNP:138925964
1884+c, tdbSNP:199469500
complement(1894)-g, adbSNP:373336653
complement(1920)-g, cdbSNP:143448451
complement(1935)-t, cdbSNP:371028997
complement(1937)-t, cdbSNP:55897523
complement(2018)-dbSNP:
complement(2018)-t, cdbSNP:184798444
2021+a, tdbSNP:199469503
2022+c, g, tdbSNP:121918476
complement(2023)-t, cdbSNP:377174703
complement(2058)-g, adbSNP:202089574
complement(2088)-t, gdbSNP:139479630
complement(2101)-g, adbSNP:200228050
complement(2102)-g, cdbSNP:148234743
complement(2103)-t, cdbSNP:142846443
complement(2136)-g, cdbSNP:193013939
complement(2157)-t, cdbSNP:371885410
complement(2184)-t, cdbSNP:368612500
complement(2188)-g, adbSNP:145711536
complement(2192)-t, cdbSNP:372298532
complement(2230)-dbSNP:
complement(2230)-g, adbSNP:202190731
complement(2248)-t, cdbSNP:368173480
complement(2269)-t, adbSNP:140472966
complement(2319)-t, cdbSNP:375706546
complement(2322)-t, cdbSNP:141122478
complement(2331)-g, adbSNP:147324335
2342+a, gdbSNP:6123
2372+a, tdbSNP:267606981
complement(2404)-t, gdbSNP:199820528
complement(2569)-g, adbSNP:182088150
complement(2742)-t, cdbSNP:144135580
2752+a, tdbSNP:138546241
complement(2841)-t, gdbSNP:147496684
complement(2841)-c, adbSNP:386470226
complement(2892)-t, gdbSNP:9681204
complement(3065)-t, cdbSNP:189450409
complement(3114)-g, adbSNP:374824636
complement(3126)-t, gdbSNP:60153116
complement(3151)-c, adbSNP:112945093
3155+a, gdbSNP:137965257
complement(3477)-g, adbSNP:186560028
complement(3542)-t, cdbSNP:140073790
Gene SymbolPROS1
Gene SynonymPROS; PS21; PS22; PS23; PS24; PS25; PSA; THPH5; THPH6
Chromosome3
Locus Map3q11.2
All Transcripts
RefSeq Accession Definition Stock Status Price Turnaround time Business Day Select
NM_000313 Homo sapiens protein S (alpha) (PROS1), mRNA. In-stock $99.00 5-7
NM_000313 Homo sapiens protein S (alpha) (PROS1), mRNA. In-stock $99.00 5-7
Title Protein S is a cofactor for platelet and endothelial tissue factor pathway inhibitor-alpha but not for cell surface-associated tissue factor pathway inhibitor .
Author Wood JP, Ellery PE, Maroney SA and Mast AE.
Journal Arterioscler. Thromb. Vasc. Biol. 34 (1), 169-176 (2014)
Title Protein S levels and the risk of venous thrombosis: results from the MEGA case-control study .
Author Pintao MC, Ribeiro DD, Bezemer ID, Garcia AA, de Visser MC, Doggen CJ, Lijfering WM, Reitsma PH and Rosendaal FR.
Journal Blood 122 (18), 3210-3219 (2013)
Title Plasma protein S residues 37-50 mediate its binding to factor Va and inhibition of blood coagulation .
Author Heeb MJ, Mesters RM, Fernandez JA, Hackeng TM, Nakasone RK and Griffin JH.
Journal Thromb. Haemost. 110 (2), 275-282 (2013)
Title T cell-derived protein S engages TAM receptor signaling in dendritic cells to control the magnitude of the immune response .
Author Carrera Silva EA, Chan PY, Joannas L, Errasti AE, Gagliani N, Bosurgi L, Jabbour M, Perry A, Smith-Chakmakova F, Mucida D, Cheroutre H, Burstyn-Cohen T, Leighton JA, Lemke G, Ghosh S and Rothlin CV.
Journal Immunity 39 (1), 160-170 (2013)
Title Reevaluation of total, free, and bound protein S and C4b-binding protein levels in plasma anticoagulated with citrate or hirudin .
Author Griffin JH, Gruber A and Fernandez JA.
Journal Blood 79 (12), 3203-3211 (1992)
Title Protein-S, a vitamin K-dependent protein, is a bone matrix component synthesized and secreted by osteoblasts .
Author Maillard C, Berruyer M, Serre CM, Dechavanne M and Delmas PD.
Journal Endocrinology 130 (3), 1599-1604 (1992)
Title A novel functional assay of protein C in human plasma and its comparison with amidolytic and anticoagulant assays .
Author Guglielmone HA and Vides MA.
Journal Thromb. Haemost. 67 (1), 46-49 (1992)
Title Intron-exon organization of the active human protein S gene PS alpha and its pseudogene PS beta: duplication and silencing during primate evolution .
Author Ploos van Amstel HK, Reitsma PH, van der Logt CP and Bertina RM.
Journal Biochemistry 29 (34), 7853-7861 (1990)
Title Organization of the human protein S genes .
Author Schmidel DK, Tatro AV, Phelps LG, Tomczak JA and Long GL.
Journal Biochemistry 29 (34), 7845-7852 (1990)
Title Radiation-induced damage in T4 bacteriophage: the effect of superoxide radicals and molecular oxygen .
Author Samuni,A., Chevion,M., Halpern,Y.S., Ilan,Y.A. and Czapski,G.
Journal Radiat. Res. 75 (3), 489-496 (1978)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.