• THAT   AND
  • THAT   AND


Homo sapiens parathyroid hormone (PTH), mRNA.


RefSeq Accession Definition Sequence Price Select
NM_000315 Homo sapiens parathyroid hormone (PTH), mRNA. Full Lenth $240.12
ORF Sequence $159.00
RefSeq Version NM_000315.2, 39995098
Length 828 bp
Structure linear
Update Date 30-APR-2011
Organism Homo sapiens (human)
Definition Homo sapiens parathyroid hormone (PTH), mRNA.
Product parathyroid hormone preproprotein
Comment

Summary: The protein encoded by this gene is a hormone secreted by parathyroid cells. This hormone elevates blood Ca2+ level by dissolving the salts in bone and preventing their renal excretion. Defects in this gene are a cause of familial isolated hypoparathyroidism (FIH). [provided by RefSeq].

RefSeq NP_000306.1
CDS 116..463
Exon (1)1..110
Exon (2)1..110
Exon (3)111..201
Exon (4)202..814
Translation MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Order your protein of interest with our Guaranteed or It's Free Service now! For details, please click here.
Position Chain Variation Link
167+c, tdbSNP:104894271
182+c, tdbSNP:104894272
complement(350..351)-, gdbSNP:35645521
362+a, c, tdbSNP:6256
complement(391)-t, cdbSNP:76760723
complement(649..650)-, aadbSNP:111527388
complement(679)-c, adbSNP:35424808
complement(696)-t, cdbSNP:116938134
737+a, tdbSNP:10189
complement(782)-t, cdbSNP:16912873
Gene SymbolPTH
Gene SynonymPTH1
Chromosome11
Locus Map11p15.3-p15.1
All Transcripts NM_000315
Title Influence of gene variants related to calcium homeostasis on biochemical parameters of women with polycystic ovary syndrome .
Author Ranjzad,F., Mahban,A., Irani Shemirani,A., Mahmoudi,T., Vahedi,M., Nikzamir,A. and Zali,M.R.
Journal J. Assist. Reprod. Genet. 28 (3), 225-232 (2011)
Title Vitamin D deficiency and parathyroid hormone levels following renal transplantation in children .
Author Tuchman,S., Kalkwarf,H.J., Zemel,B.S., Shults,J., Wetzsteon,R.J., Foerster,D., Strife,C.F. and Leonard,M.B.
Journal Pediatr. Nephrol. 25 (12), 2509-2516 (2010)
Title Comprehensive association analysis of nine candidate genes with serum 25-hydroxy vitamin D levels among healthy Caucasian subjects .
Author Bu,F.X., Armas,L., Lappe,J., Zhou,Y., Gao,G., Wang,H.W., Recker,R. and Zhao,L.J.
Journal Hum. Genet. 128 (5), 549-556 (2010)
Title Thymus-associated parathyroid hormone has two cellular origins with distinct endocrine and immunological functions .
Author Liu,Z., Farley,A., Chen,L., Kirby,B.J., Kovacs,C.S., Blackburn,C.C. and Manley,N.R.
Journal PLoS Genet. 6 (12), E1001251 (2010)
Title Disruption of PTH receptor 1 in T cells protects against PTH-induced bone loss .
Author Tawfeek,H., Bedi,B., Li,J.Y., Adams,J., Kobayashi,T., Weitzmann,M.N., Kronenberg,H.M. and Pacifici,R.
Journal PLoS ONE 5 (8), E12290 (2010)
Title Ectopic transcription of the parathyroid hormone gene in lymphocytes, lymphoblastoid cells and tumour tissue .
Author Handt,O., Reis,A. and Schmidtke,J.
Journal J. Endocrinol. 135 (2), 249-256 (1992)
Title A donor splice site mutation in the parathyroid hormone gene is associated with autosomal recessive hypoparathyroidism .
Author Parkinson,D.B. and Thakker,R.V.
Journal Nat. Genet. 1 (2), 149-152 (1992)
Title The immune response of Lewis rats to peptide 68-88 of guinea pig myelin basic protein. I. T cell determinants .
Author Chou,C.H., Fritz,R.B., Chou,F.C. and Kibler,R.F.
Journal J. Immunol. 123 (4), 1540-1543 (1979)
Title Complete amino acid sequence of human parathyroid hormone .
Author Keutmann,H.T., Sauer,M.M., Hendy,G.N., O'Riordan,L.H. and Potts,J.T. Jr.
Journal Biochemistry 17 (26), 5723-5729 (1978)
Title A reinvestigation of the amino-terminal sequence of human parathyroid hormone .
Author Keutmann,H.T., Niall,H.D., O'Riordan,J.L. and Potts,J.T. Jr.
Journal Biochemistry 14 (9), 1842-1847 (1975)

Our customer service representatives are available 24 hours a day, Monday through Friday; please contact us anytime for assistance.

Secured Online Quotation
Email: gene@genscript.com
Phone: 1-877-436-7274 (Toll-Free) 1-732-885-9188
Fax: 1-732-210-0262 1-732-885-5878